Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ATCOX17.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15352 97 / 1e-28 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1) AT1G53030 93 / 6e-27 Cytochrome C oxidase copper chaperone (COX17) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G400000 [exp] 137 / 3e-44 AT3G15352 102 / 6e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035780 [exp] 98 / 1e-28 AT3G15352 103 / 5e-31 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1) Lus10037356 [exp] 98 / 1e-28 AT3G15352 101 / 3e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1) Lus10018872 [exp] 92 / 4e-26 AT3G15352 94 / 3e-27 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [poplar] [flax] CHCH PF05051 [poplar] [flax] COX17 Cytochrome C oxidase copper chaperone (COX17)
Representative CDS sequence Show only first row Show all	>Potri.011G119000.5 pacid=42781414 polypeptide=Potri.011G119000.5.p locus=Potri.011G119000 ID=Potri.011G119000.5.v4.1 annot-version=v4.1 ATGAGTGGGCTACCTTTGCAAAATGCTTCCCCTTCCTCAGCTGTAAGCCAGGTGTCACTAATTACAACATCTGGTCAAGAATCAAAGCCAAAGAAGAAGA TCTGCTGTGCTTGCCCTGAAACTAAGAAACTAAGGGATGAATGCGTTGTGGAGCATGGTGAAGCTGCTTGTGCAAAATGGATCGATGCTCATCGACAGTG CCTTCGTGCTGAGGGCTTTAACATTTGA
AA sequence Show only first row Show all	>Potri.011G119000.5 pacid=42781414 polypeptide=Potri.011G119000.5.p locus=Potri.011G119000 ID=Potri.011G119000.5.v4.1 annot-version=v4.1 MSGLPLQNASPSSAVSQVSLITTSGQESKPKKKICCACPETKKLRDECVVEHGEAACAKWIDAHRQCLRAEGFNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Potri.011G119000 [exp]	0	1	ATCOX17.1
AT1G73030		CHMP1A, VPS46.2	CHARGED MULTIVESICULAR BODY PR...		Potri.006G158538 [exp]	2.23	0.8456
AT4G28440			Nucleic acid-binding, OB-fold-...		Potri.007G137600 [exp]	7.34	0.8150
AT1G73030		CHMP1A, VPS46.2	CHARGED MULTIVESICULAR BODY PR...		Potri.001G194400 [exp]	7.74	0.8053
AT1G29040			unknown protein		Potri.011G064600 [exp]	7.93	0.7833
AT5G22210			unknown protein		Potri.004G201000 [exp]	8.66	0.8065
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Potri.006G124100 [exp]	10.24	0.7565
AT1G43900			Protein phosphatase 2C family ...		Potri.005G186001 [exp]	10.58	0.7894
AT1G52740		HTA9	histone H2A protein 9 (.1)		Potri.006G249400 [exp]	11.13	0.8068	HTA906
AT2G35605			SWIB/MDM2 domain superfamily p...		Potri.005G078400 [exp]	13.67	0.7707
AT5G12180		CPK17	calcium-dependent protein kina...		Potri.004G204700 [exp]	19.07	0.7120

Compare expression of checked genes

Potri.011G119000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.