Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14200 60 / 8e-12 RING/U-box superfamily protein (.1) AT5G41440 57 / 3e-11 RING/U-box superfamily protein (.1) AT1G74620 59 / 5e-11 RING/U-box superfamily protein (.1) AT5G41450 57 / 1e-10 RING/U-box superfamily protein (.1) AT3G19950 57 / 2e-10 RING/U-box superfamily protein (.1) AT5G41430 56 / 3e-10 RING/U-box superfamily protein (.1) AT4G30370 55 / 6e-10 RING/U-box superfamily protein (.1) AT1G04360 56 / 7e-10 RING/U-box superfamily protein (.1) AT5G56340 56 / 9e-10 ATCRT1 RING/U-box superfamily protein (.1) AT5G47610 54 / 9e-10 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G400600 [exp] 132 / 3e-40 AT2G20650 59 / 8e-11 RING/U-box superfamily protein (.1.2) Potri.010G245801 [exp] 93 / 1e-24 AT2G27940 61 / 1e-11 RING/U-box superfamily protein (.1) Potri.001G235100 [exp] 55 / 8e-10 AT1G04360 98 / 3e-24 RING/U-box superfamily protein (.1) Potri.003G130900 [exp] 54 / 1e-09 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.001G091700 [exp] 55 / 2e-09 AT5G53110 223 / 1e-69 RING/U-box superfamily protein (.1) Potri.001G088400 [exp] 55 / 2e-09 AT4G24015 117 / 1e-32 RING/U-box superfamily protein (.1) Potri.003G223200 [exp] 55 / 2e-09 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1) Potri.001G212101 [exp] 54 / 2e-09 AT2G27940 96 / 2e-23 RING/U-box superfamily protein (.1) Potri.003G142600 [exp] 54 / 3e-09 AT4G24015 144 / 3e-43 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021524 [exp] 61 / 1e-11 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1) Lus10033425 [exp] 59 / 3e-11 AT3G10910 82 / 6e-20 RING/U-box superfamily protein (.1) Lus10032418 [exp] 58 / 8e-11 AT4G24015 180 / 9e-58 RING/U-box superfamily protein (.1) Lus10032290 [exp] 57 / 1e-10 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10024657 [exp] 56 / 3e-10 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10023055 [exp] 56 / 6e-10 AT4G24015 181 / 5e-58 RING/U-box superfamily protein (.1) Lus10020258 [exp] 56 / 8e-10 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3) Lus10022223 [exp] 56 / 8e-10 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1) Lus10035931 [exp] 54 / 2e-09 AT4G40070 94 / 3e-23 RING/U-box superfamily protein (.1) Lus10003400 [exp] 53 / 2e-09 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.011G119900.1 pacid=42780684 polypeptide=Potri.011G119900.1.p locus=Potri.011G119900 ID=Potri.011G119900.1.v4.1 annot-version=v4.1 ATGACAGAAAACCTAGTTGCTTCTCCCTCTCAGCTGATCATTCTTACACTTGTACTGCTCTCCGTTGCATTAACAGTACTACTCGTCGTGATGGTTTATG GACTAGTAAGCTTGTGTTGGAGTTGTTTGGAAAATCGGCTCGATATTCTCCTTAGCCAAGATCACCATCCTCATGATGTAGAAAGAGGACAGGTAACCGG AAAAGAACAACCTGCTACTGTTGTCAGCTTGCGATTTTCTATCATCCAAGTCGATGAAACTACAGAGTATTTTAGCAATGGATGTGCGATATGCTTGGAT GATTTTCAAAAGGGGGTGGACTGCTGTGTTCTTTCGTCGTGCAAACATGTTTTCCATTCAAGCTGTTTAAAGCAATGGCTGGAACTGAATCTGACCTGCC CTCTTTGTAGAAGTTATGCATATGATGACATGCTTCTCTGTTAG
AA sequence Show only first row Show all	>Potri.011G119900.1 pacid=42780684 polypeptide=Potri.011G119900.1.p locus=Potri.011G119900 ID=Potri.011G119900.1.v4.1 annot-version=v4.1 MTENLVASPSQLIILTLVLLSVALTVLLVVMVYGLVSLCWSCLENRLDILLSQDHHPHDVERGQVTGKEQPATVVSLRFSIIQVDETTEYFSNGCAICLD DFQKGVDCCVLSSCKHVFHSSCLKQWLELNLTCPLCRSYAYDDMLLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14200			RING/U-box superfamily protein...		Potri.011G119900 [exp]	0	1
AT5G20950			Glycosyl hydrolase family prot...		Potri.008G013700 [exp]	7.21	0.6551
					Potri.004G151301 [exp]	8.48	0.7156
					Potri.011G164750 [exp]	8.77	0.7127
					Potri.013G094950 [exp]	9.48	0.6715
					Potri.016G095001 [exp]	9.79	0.6041
AT5G18310			unknown protein		Potri.015G040500 [exp]	10.24	0.6136
					Potri.001G007232 [exp]	15.42	0.6029
AT5G26594		ARR24	response regulator 24 (.1)		Potri.002G253100 [exp]	16.49	0.5429
AT5G61630			unknown protein		Potri.001G080500 [exp]	19.44	0.5874
AT5G28780			PIF1 helicase (.1)		Potri.012G073100 [exp]	21.56	0.5512

Compare expression of checked genes

Potri.011G119900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.