Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ATHM4.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15360 190 / 9e-62 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G03680 170 / 4e-54 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT4G03520 163 / 3e-51 ATHM2 Thioredoxin superfamily protein (.1.2) AT2G15570 131 / 5e-39 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT1G76760 83 / 3e-20 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 81 / 4e-19 ATY2 thioredoxin Y2 (.1) AT1G50320 79 / 1e-18 ATHX, ATX thioredoxin X (.1) AT1G19730 72 / 3e-16 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT4G12170 71 / 4e-16 Thioredoxin superfamily protein (.1) AT5G39950 69 / 3e-15 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G401500 [exp] 268 / 2e-92 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.013G132200 [exp] 184 / 3e-59 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 183 / 5e-59 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.005G058400 [exp] 176 / 2e-56 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 174 / 3e-55 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 171 / 2e-54 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 132 / 3e-39 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.005G193400 [exp] 84 / 2e-20 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.002G066800 [exp] 82 / 1e-19 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014798 [exp] 206 / 2e-68 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 205 / 5e-68 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 171 / 1e-54 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 171 / 1e-54 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 171 / 2e-54 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014069 [exp] 125 / 2e-36 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10019847 [exp] 125 / 2e-36 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10028569 [exp] 84 / 3e-20 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10018875 [exp] 83 / 4e-20 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10030666 [exp] 72 / 5e-16 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF13098 [poplar] [flax] Thioredoxin_2 Thioredoxin-like domain
Representative CDS sequence Show only first row Show all	>Potri.011G120700.2 pacid=42781006 polypeptide=Potri.011G120700.2.p locus=Potri.011G120700 ID=Potri.011G120700.2.v4.1 annot-version=v4.1 ATGGCTACTGTACTTGAATCCCTCACCGCTCCTTCTCGCTCTTCTGCTGTCTTGCCTAAACCTACTACTACGCTTGTCACTGCTTTTGCTTCAACTATTA ATCGGAGATCGCTTCGCTTCCCACAACTCAAAGGCCTTAAGATTCACTTTCATTCTTCATCGACTGTAAATCGCTCTCTCGGATCGGTGAGTCAGAGTAG TTCTAGACTCGCTTGTGCTGGAAGGATCGTTTGTGAAGCGCAGGACATTGCTGTTAAAGTGCCCGCTGTTACTGATGCAACATGGAAGTCACTTGTGCTG GAATCGGAATCCCCTGTTCTGGTTGAATTCTGGGCTCCATGGTGTGGTCCGTGCCGGATGATTCACCCTGTAATTGATGAACTGGCAAATCAATATGCTG GAAAGCTCAAGTGCTACAAGCTTAACACTGACGACTGTTCTTCAATTGCAACTGAGTATGGGATTCGAAGCATTCCCACTGTTATCATCTTTAAAAATGG TGAGAAGAAAGAGGCCATTATTGGTGCTGTTCCCAAAACTACCTTAACCACCAGTATCGAGAAATTCTTGTAA
AA sequence Show only first row Show all	>Potri.011G120700.2 pacid=42781006 polypeptide=Potri.011G120700.2.p locus=Potri.011G120700 ID=Potri.011G120700.2.v4.1 annot-version=v4.1 MATVLESLTAPSRSSAVLPKPTTTLVTAFASTINRRSLRFPQLKGLKIHFHSSSTVNRSLGSVSQSSSRLACAGRIVCEAQDIAVKVPAVTDATWKSLVL ESESPVLVEFWAPWCGPCRMIHPVIDELANQYAGKLKCYKLNTDDCSSIATEYGIRSIPTVIIFKNGEKKEAIIGAVPKTTLTTSIEKFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15360		ATHM4, ATM4, TR...	ARABIDOPSIS THIOREDOXIN M-TYPE...		Potri.011G120700 [exp]	0	1	ATHM4.2
AT1G32990		PRPL11	plastid ribosomal protein l11 ...		Potri.011G150700 [exp]	1.41	0.9157
AT1G53520			Chalcone-flavanone isomerase f...		Potri.011G101800 [exp]	16.43	0.8929
AT1G03310		ATISA2, ISA2, D...	BRANCHING ENZYME 2, ARABIDOPSI...		Potri.002G219900 [exp]	21.44	0.8954
AT2G04790			unknown protein		Potri.014G162700 [exp]	26.03	0.8811
AT3G60210			GroES-like family protein (.1)		Potri.014G044300 [exp]	31.49	0.8481	CPN10.4
AT1G04940		AtTic20-I, atTI...	translocon at the inner envelo...		Potri.002G031800 [exp]	31.74	0.8610
AT4G24660	ZF_HD	ATHB22, MEE68, ...	ZINC FINGER HOMEODOMAIN 2, MAT...		Potri.012G040900 [exp]	31.74	0.8651
AT5G08400			Protein of unknown function (D...		Potri.010G255300 [exp]	32.24	0.8787
AT2G44640			unknown protein		Potri.014G044200 [exp]	35.91	0.8658
AT5G16710		DHAR3	dehydroascorbate reductase 1 (...		Potri.017G125100 [exp]	37.52	0.8730

Compare expression of checked genes

Potri.011G120700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.