Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15430 744 / 0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT3G26100 202 / 1e-58 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G63860 151 / 2e-40 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G42140 137 / 3e-34 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 134 / 4e-33 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT5G12350 133 / 7e-33 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G76950 129 / 1e-31 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G16040 120 / 9e-30 Regulator of chromosome condensation (RCC1) family protein (.1) AT1G65920 123 / 1e-29 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G69710 115 / 4e-27 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G402800 [exp] 922 / 0 AT3G15430 723 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Potri.015G009400 [exp] 201 / 3e-58 AT3G26100 809 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Potri.012G018600 [exp] 193 / 2e-55 AT3G26100 798 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Potri.007G100200 [exp] 149 / 6e-40 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G276900 [exp] 134 / 3e-33 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.009G071800 [exp] 132 / 1e-32 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.008G167500 [exp] 127 / 5e-31 AT4G14368 1266 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.004G101800 [exp] 124 / 6e-31 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.017G113200 [exp] 122 / 2e-30 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011399 [exp] 185 / 2e-52 AT3G26100 805 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10006455 [exp] 185 / 3e-52 AT3G26100 809 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10006242 [exp] 178 / 1e-49 AT3G26100 796 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10039618 [exp] 154 / 2e-41 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10029536 [exp] 142 / 4e-37 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Lus10036945 [exp] 140 / 1e-36 AT3G26100 565 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10009701 [exp] 137 / 4e-34 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10036030 [exp] 137 / 5e-34 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10037192 [exp] 134 / 5e-33 AT1G69710 986 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10036737 [exp] 131 / 4e-32 AT1G69710 974 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [poplar] [flax] Beta_propeller PF00415 [poplar] [flax] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Potri.011G121900.2 pacid=42782084 polypeptide=Potri.011G121900.2.p locus=Potri.011G121900 ID=Potri.011G121900.2.v4.1 annot-version=v4.1 ATGGCCGATAAGAATAGATCGGTTTCCATCGAGGATTTGCCATCACATTTGATTTTTGAGATACTGACCACTGGTAGGCTCAGTGCGGTTGACCTCGCGT GTTTAGAGTTGACTTCTAGGACATTTGGAGGGAGTCATGGGTTGTACCCTCAAAAGTTTAGGTCGCTGGTGGACTTTGCAGCGTATCAGCTGTGTGTGTC TCATAGAGTGTATAGTGGGATGGGGTGGAATGCTCAGAAAGGGTTGTTTGGTCGATGTGAAGGGAATTGGAAGCGGGTTTTGAGGTTCTTGCAAGCCGTG GAGGAATCGTCAGGCATGGTCAAGACCTCAGCATCCAATATGCAGGTCACAACCGGAAGATATCACACATTGCTGATCAGAGATTCATCTGTATATTCTT GTGGTTCCAGTTTGTGTGGCGTTCTTGGACATGGTGCTGAAACAACACAATGTGTAGCATTCACACGGATTAGATTCCCATCTTTGGCTTATGTGATCCA AGTCTCAGCCTCCCATAATCATGCTGCTTTTGTTTTGCAGTCCGGAGAGGTTTTCACATGCGGTGATAATTCATCATTTTGCTGCGGCCACAATGATACT AATCGCCCCATATTTAGGCCTAGGCTAGTTGAGGCACTGAAGGGAGTTCCATGCAAGCAGGTTGCTGTTGGCCTTAACTTTACAGTGTTCCTCACAAGAC AAGGCCAGCTTTATACTTGTGGAACGAACACACATGGGCAACTTGGTCATGGTGACACACAAGACAGACCAACACCCAAAATCATTGAACTGCTTGAGGG AGTTGGTTCTGTGGTTCAAATAGCTGCTGGTCCCAGTTACGTTTTAGCTGTAACTGACAACGGTGTAGTTTACTCTTTTGGTTCTGGTTCTAATTTGTGT CTTGGTCATGGAGAGCAACATGATGAGTTCCGGCCACGTGCAATCCAGACATTTAGAAGAAAGGATATTCATGTGGTCCACGTGTCTGCTGGGGATGAGC ATGCAGTGGCACTTGATTCAAGTGGATTTGTCTATAGTTGGGGAAAAGGTTACTGTGGAGCGTTAGGCCACGGCGATGAGATTGATAAGACTCTTCCTGC ACTTGTGAACTGCCTTAAGAGCCACCTTGCTGTGCAGGTTTGTGCAAGAAAAAGGAAAACATTTGTTCTGGTTGATGGGGGTTCTGTTTATGGCTTTGGG TGGATGGGATTTGGTAGCCTTGGCTTTCCTGATAGGGGTGTATCTGATAAAGTGATGAGACCTAGAGTCCTTGATAGCTTAAGAGCTCGTCATGTTTCTC AGATCAGCACAGGCCTCTACCACACTGTTGTGGTTACTAACCAGGGCCAAATGTTTGGATTTGGAGATAATGAAAGAGCACAACTTGGGCATGACACATT GAGGGGATGCCTACAGCCGACTGAAATCTTTGTTCAAGAAACAGCAGATGATACAGGTCTTGCTTCGGAAGGCAAATGA
AA sequence Show only first row Show all	>Potri.011G121900.2 pacid=42782084 polypeptide=Potri.011G121900.2.p locus=Potri.011G121900 ID=Potri.011G121900.2.v4.1 annot-version=v4.1 MADKNRSVSIEDLPSHLIFEILTTGRLSAVDLACLELTSRTFGGSHGLYPQKFRSLVDFAAYQLCVSHRVYSGMGWNAQKGLFGRCEGNWKRVLRFLQAV EESSGMVKTSASNMQVTTGRYHTLLIRDSSVYSCGSSLCGVLGHGAETTQCVAFTRIRFPSLAYVIQVSASHNHAAFVLQSGEVFTCGDNSSFCCGHNDT NRPIFRPRLVEALKGVPCKQVAVGLNFTVFLTRQGQLYTCGTNTHGQLGHGDTQDRPTPKIIELLEGVGSVVQIAAGPSYVLAVTDNGVVYSFGSGSNLC LGHGEQHDEFRPRAIQTFRRKDIHVVHVSAGDEHAVALDSSGFVYSWGKGYCGALGHGDEIDKTLPALVNCLKSHLAVQVCARKRKTFVLVDGGSVYGFG WMGFGSLGFPDRGVSDKVMRPRVLDSLRARHVSQISTGLYHTVVVTNQGQMFGFGDNERAQLGHDTLRGCLQPTEIFVQETADDTGLASEGK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15430			Regulator of chromosome conden...		Potri.011G121900 [exp]	0	1
AT2G03690			coenzyme Q biosynthesis Coq4 f...		Potri.008G097100 [exp]	6.92	0.8421
AT5G35750		AHK2	histidine kinase 2 (.1)		Potri.014G164700 [exp]	8.12	0.8126
AT1G79990			structural molecules (.1.2.3.4...		Potri.003G056100 [exp]	10.72	0.8594
AT1G67040			unknown protein		Potri.017G116000 [exp]	13.26	0.8511
AT5G45500			RNI-like superfamily protein (...		Potri.019G036900 [exp]	14.07	0.7919
AT5G03040		IQD2	IQ-domain 2 (.1.2.3)		Potri.016G086300 [exp]	15.49	0.8515
AT3G15940			UDP-Glycosyltransferase superf...		Potri.001G179000 [exp]	16.43	0.8214
					Potri.012G067350 [exp]	23.55	0.8447
AT3G05320			O-fucosyltransferase family pr...		Potri.012G118800 [exp]	26.98	0.8441
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Potri.006G090300 [exp]	34.08	0.7682

Compare expression of checked genes

Potri.011G121900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.