Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27450 428 / 9e-154 Aluminium induced protein with YGL and LRDR motifs (.1) AT3G15450 375 / 1e-132 Aluminium induced protein with YGL and LRDR motifs (.1.2.3) AT5G43830 237 / 2e-78 Aluminium induced protein with YGL and LRDR motifs (.1) AT3G22850 219 / 2e-71 Aluminium induced protein with YGL and LRDR motifs (.1) AT5G19140 194 / 6e-62 AtAILP1, AILP1 Aluminium induced protein with YGL and LRDR motifs (.1.2) AT5G10240 52 / 1e-07 ASN3 asparagine synthetase 3 (.1.2) AT5G65010 52 / 2e-07 ASN2 asparagine synthetase 2 (.1.2) AT3G47340 47 / 7e-06 AT-ASN1, DIN6, ASN1 DARK INDUCIBLE 6, ARABIDOPSIS THALIANA GLUTAMINE-DEPENDENT ASPARAGINE SYNTHASE 1, glutamine-dependent asparagine synthase 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G403000 [exp] 493 / 1e-179 AT4G27450 436 / 3e-157 Aluminium induced protein with YGL and LRDR motifs (.1) Potri.011G049900 [exp] 369 / 2e-130 AT4G27450 383 / 6e-136 Aluminium induced protein with YGL and LRDR motifs (.1) Potri.004G040600 [exp] 366 / 2e-129 AT4G27450 366 / 2e-129 Aluminium induced protein with YGL and LRDR motifs (.1) Potri.008G158400 [exp] 238 / 1e-78 AT5G43830 388 / 3e-138 Aluminium induced protein with YGL and LRDR motifs (.1) Potri.010G081600 [exp] 232 / 2e-76 AT5G43830 391 / 3e-139 Aluminium induced protein with YGL and LRDR motifs (.1) Potri.008G203400 [exp] 178 / 1e-55 AT5G19140 397 / 4e-142 Aluminium induced protein with YGL and LRDR motifs (.1.2) Potri.001G278400 [exp] 54 / 4e-08 AT3G47340 1018 / 0.0 DARK INDUCIBLE 6, ARABIDOPSIS THALIANA GLUTAMINE-DEPENDENT ASPARAGINE SYNTHASE 1, glutamine-dependent asparagine synthase 1 (.1.2.3) Potri.009G072900 [exp] 52 / 2e-07 AT3G47340 1027 / 0.0 DARK INDUCIBLE 6, ARABIDOPSIS THALIANA GLUTAMINE-DEPENDENT ASPARAGINE SYNTHASE 1, glutamine-dependent asparagine synthase 1 (.1.2.3) Potri.005G075700 [exp] 43 / 0.0001 AT5G10240 1039 / 0.0 asparagine synthetase 3 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033418 [exp] 377 / 1e-133 AT4G27450 369 / 2e-130 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10034883 [exp] 372 / 1e-131 AT4G27450 365 / 6e-129 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10018484 [exp] 305 / 6e-105 AT4G27450 305 / 3e-105 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10011191 [exp] 291 / 1e-99 AT4G27450 303 / 2e-104 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10006624 [exp] 233 / 1e-76 AT5G43830 374 / 2e-132 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10041181 [exp] 231 / 4e-76 AT5G43830 369 / 1e-130 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10039382 [exp] 230 / 1e-75 AT5G43830 372 / 6e-132 Aluminium induced protein with YGL and LRDR motifs (.1) Lus10010505 [exp] 185 / 3e-58 AT5G19140 392 / 4e-140 Aluminium induced protein with YGL and LRDR motifs (.1.2) Lus10034038 [exp] 181 / 1e-56 AT5G19140 389 / 3e-139 Aluminium induced protein with YGL and LRDR motifs (.1.2) Lus10021899 [exp] 94 / 2e-21 AT1G04210 609 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF12481 [poplar] [flax] DUF3700 Aluminium induced protein
Representative CDS sequence Show only first row Show all	>Potri.011G122100.1 pacid=42781948 polypeptide=Potri.011G122100.1.p locus=Potri.011G122100 ID=Potri.011G122100.1.v4.1 annot-version=v4.1 ATGTTGGCAATATTTCACAAAGCTTTTGCTAACCCACCTGAGGAGCTTAATAGTCCAGCATCTCAAAGAAGTACTAGGAAGCCTAAGCTTCCTGATGAAA CTCTGAGTGAGTTTCTTTCTCACCACCCTCAGAAGACTTTCTCCATAAACTTTGGTGAAGCTGCAGTGCTTGCTTATGTTCCCCAAGACAGCCCTTTCTC TCCACAACAAAGGTTGTTTTGTGGTTTTGAGGGTATATACTGCCTTTTCTCTGGAAGCTTGAACAATTTATGCACACTCAATAAGCAGTATGGATTAACA AAGGGGACTAATGAGGCCATGTTTGTGATAGAAGCTTTCAAGACCCTTCGTGACAGGGGTCCATATCCAGCTGATCAAGTTGTCAAGGATCTTGATGGGA GCTTTGCTTTTGTTATCTACGATAGCAAGGCAGGAACCGTTTTCGCTGCACTGGGCTCCGATGGTGGAGTTAAGCTGTACTGGGGTATAGCAGCAGATGG CTCTGTGGTGATTTCTGATGATTTGGAAATCATAAAAGCTGGCTGTGCCAAATCATTTGCTCCCTTCCCAACAGGATTTATCTTCCATAGTGAAGGAGGT TTGATGAGCTTTGAGCATCCGATGAACAAAGTTAGAGCCATGCCAAGGACCGACAGCGAAGGATTCCTGTGTGGTGCAAATTTCAAGGTTGATGTCTTCA CAAGAATTAATAGCTTACCCCGTAGGGGAAGTGAGGCCAATTGGACCGAATGGGAATCACACAGCTGA
AA sequence Show only first row Show all	>Potri.011G122100.1 pacid=42781948 polypeptide=Potri.011G122100.1.p locus=Potri.011G122100 ID=Potri.011G122100.1.v4.1 annot-version=v4.1 MLAIFHKAFANPPEELNSPASQRSTRKPKLPDETLSEFLSHHPQKTFSINFGEAAVLAYVPQDSPFSPQQRLFCGFEGIYCLFSGSLNNLCTLNKQYGLT KGTNEAMFVIEAFKTLRDRGPYPADQVVKDLDGSFAFVIYDSKAGTVFAALGSDGGVKLYWGIAADGSVVISDDLEIIKAGCAKSFAPFPTGFIFHSEGG LMSFEHPMNKVRAMPRTDSEGFLCGANFKVDVFTRINSLPRRGSEANWTEWESHS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27450			Aluminium induced protein with...		Potri.011G122100 [exp]	0	1
AT2G03890		UBDKGAMMA7, ATP...	UBIQUITIN-LIKE DOMAIN KINASE G...		Potri.008G112200 [exp]	2.64	0.7038
AT1G53320	TUB	AtTLP7	tubby like protein 7 (.1)		Potri.001G390200 [exp]	3.00	0.6847
AT1G20460			unknown protein		Potri.005G248300 [exp]	6.32	0.6770
AT3G47160			RING/U-box superfamily protein...		Potri.009G045400 [exp]	7.48	0.6608
AT4G10270			Wound-responsive family protei...		Potri.019G117201 [exp]	7.74	0.6878
AT4G31410			Protein of unknown function (D...		Potri.006G275400 [exp]	11.22	0.6256
AT2G19810	C3HZnF	AtOZF1	Oxidation-related Zinc Finger ...		Potri.018G058600 [exp]	16.43	0.6719
AT4G10270			Wound-responsive family protei...		Potri.019G117301 [exp]	16.61	0.6696
AT1G16180			Serinc-domain containing serin...		Potri.003G186500 [exp]	17.29	0.6259
AT4G10270			Wound-responsive family protei...		Potri.019G117200 [exp]	17.54	0.6635

Compare expression of checked genes

Potri.011G122100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.