Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G14830 137 / 4e-36 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT3G15490 100 / 1e-24 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G34220 104 / 5e-24 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G35730 100 / 9e-23 Regulator of Vps4 activity in the MVB pathway protein (.1) AT2G19710 98 / 8e-22 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G51900 88 / 2e-18 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G79910 84 / 2e-17 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G25420 81 / 6e-17 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) AT4G29440 82 / 2e-16 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G13340 73 / 9e-14 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G135700 [exp] 162 / 6e-44 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.004G038600 [exp] 130 / 1e-32 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.019G087400 [exp] 108 / 3e-25 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.007G059800 [exp] 106 / 7e-25 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.006G149800 [exp] 101 / 9e-23 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.013G117100 [exp] 100 / 2e-22 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.008G121300 [exp] 94 / 3e-21 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Potri.010G127000 [exp] 93 / 2e-20 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.003G054500 [exp] 91 / 1e-19 AT1G79910 216 / 4e-65 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033703 [exp] 152 / 5e-41 AT2G14830 210 / 8e-62 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10039808 [exp] 151 / 9e-41 AT2G14830 181 / 2e-51 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10018577 [exp] 152 / 1e-40 AT2G14830 170 / 8e-47 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10006061 [exp] 118 / 8e-29 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10028724 [exp] 117 / 1e-28 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10041836 [exp] 105 / 2e-24 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10000978 [exp] 103 / 2e-23 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10028383 [exp] 102 / 2e-23 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10040542 [exp] 100 / 2e-22 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10041468 [exp] 99 / 2e-22 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03398 [poplar] [flax] Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence Show only first row Show all	>Potri.011G122800.1 pacid=42781200 polypeptide=Potri.011G122800.1.p locus=Potri.011G122800 ID=Potri.011G122800.1.v4.1 annot-version=v4.1 ATGTGGTCTCGTGTGCTCAACATTGTGCTTGCATGGACAAAATCTTCACGATGGAGAAGAGCCTCTAGGTGCAAGAGGCTGATAGAGCAACTTCAGCTTC ATCTAGCTGCACAAAAGCACAGGAGAGAGTCAATCATACGACAATCGCGTGCCGACATCGCTCAACTCCTTCAGAATGACCGGCTTCAGCAAGCCTTAAC GAGGGTCCAGCAACTCTACAAGGACCAATGCCTATTGGCTGCATATGATCAGATCAACCAATTATGTGAATGTATCATCACCAGTATGCCCCACATTAGC CAACAACAAGCCTGGCAATGCTTGCCTATTGATGTCAGCCAGGCAATATCAAACTTAATATTTGCTTCCTCAAGATGTGGTGACCTGCCAGAGCTACACA TGCTGCGAAGCCTGTTTAAGATTCGTTATGGAAGCAAATTTGAGACTACCAATGTTGAATTATTGCCTGGAAATCTTGTGGATTCTAAGATGAAAGAGAA CTTATCTGTGAATTCAGTGCCAGAGGATGTAAAGCTATGGCTAATAAACGGAATCTCTTATGAGTACAATATTCATCTGGGATTTCAGGACTTTGGGCAT AGTTTCAGACCACAATGGCAGGAGAAAGCTGAAGTTTTGGATTTGGACATCCAAGATATTTGCAGTGACAGCGATGAGAGTTCCATACCGGCTTCAAAAC CCAGGACACCAACAACAACAAAGTCACTTTATAATGATATGGACAGAAGCAGTACTGATAGTCTGGGTAGAAGTCATATCAAGACTAAGAAAAATGAAGT TTTAATCAGAAATCTTGAAGCATCAGCAACTAGCACTTCATCTTATGGTAACCTCCCGATTCATCAGACATCTTTTATCTATCTTGATGATATGGAAGTG AAGTCTTTGAGTCAAGGTCACAGCAGCAGTAAGAAAGCTCCTAGAAGTGTGGTCGACTCCTGGAATAGCAGTACAAGCCCTAGTAGTGTCAGTAACGTGA CAAAAAGGCCAGCCAAGCCAAGGTTGGGTACGAAACCTGTACCTCCTCCCTTGAGCAATGATCATTACCGAATTTCAGTCAAAGGTCGAAGTTCTTTAGA TAGTTCAATCGATGATTGGAAAGCGCAAAGTGGAAGCTCATCTAGCTCAAGCCATGTCCACCCAAAGCTCCCAAACTATGAAGATGTAATAGCTAAATTT ACAGATATCAAGGCAGAATATAGGCACCGCAAAAGCTTTTATTATTGA
AA sequence Show only first row Show all	>Potri.011G122800.1 pacid=42781200 polypeptide=Potri.011G122800.1.p locus=Potri.011G122800 ID=Potri.011G122800.1.v4.1 annot-version=v4.1 MWSRVLNIVLAWTKSSRWRRASRCKRLIEQLQLHLAAQKHRRESIIRQSRADIAQLLQNDRLQQALTRVQQLYKDQCLLAAYDQINQLCECIITSMPHIS QQQAWQCLPIDVSQAISNLIFASSRCGDLPELHMLRSLFKIRYGSKFETTNVELLPGNLVDSKMKENLSVNSVPEDVKLWLINGISYEYNIHLGFQDFGH SFRPQWQEKAEVLDLDIQDICSDSDESSIPASKPRTPTTTKSLYNDMDRSSTDSLGRSHIKTKKNEVLIRNLEASATSTSSYGNLPIHQTSFIYLDDMEV KSLSQGHSSSKKAPRSVVDSWNSSTSPSSVSNVTKRPAKPRLGTKPVPPPLSNDHYRISVKGRSSLDSSIDDWKAQSGSSSSSSHVHPKLPNYEDVIAKF TDIKAEYRHRKSFYY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G14830			Regulator of Vps4 activity in ...		Potri.011G122800 [exp]	0	1
					Potri.001G056750 [exp]	1.00	0.9777
AT1G52827		ATCDT1	cadmium tolerance 1 (.1)		Potri.001G177333 [exp]	3.46	0.9734
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Potri.003G020400 [exp]	3.74	0.9736
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Potri.001G407100 [exp]	8.94	0.9668	Lhcb3-1,LHCB3.2
AT5G53390			O-acyltransferase (WSD1-like) ...		Potri.007G139501 [exp]	9.48	0.9532
AT4G34530	bHLH	bHLH063, CIB1	cryptochrome-interacting basic...		Potri.005G121850 [exp]	10.39	0.9565
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.011G079500 [exp]	10.95	0.9608	Lhcb1-1,Pt-LHB1.2
AT2G06510		ATRPA70A, ATRPA...	ARABIDOPSIS THALIANA RPA70-KDA...		Potri.018G065300 [exp]	15.49	0.9594
AT2G05070		LHCB2.2	LIGHT-HARVESTING CHLOROPHYLL B...		Potri.002G221400 [exp]	16.88	0.9461	2,Pt-LHCB2.1
AT5G50690		ATHSD7	hydroxysteroid dehydrogenase 7...		Potri.016G048900 [exp]	16.94	0.9582

Compare expression of checked genes

Potri.011G122800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.