Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27300 330 / 5e-108 S-locus lectin protein kinase family protein (.1) AT4G27290 307 / 1e-99 S-locus lectin protein kinase family protein (.1) AT1G65790 303 / 1e-97 ARK1 receptor kinase 1 (.1) AT4G23180 298 / 2e-97 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G11530 292 / 6e-95 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G23150 288 / 1e-93 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23140 287 / 4e-93 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23280 286 / 6e-93 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) AT4G03230 293 / 1e-92 S-locus lectin protein kinase family protein (.1) AT4G23240 276 / 1e-92 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G125301 [exp] 518 / 0 AT4G27290 775 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G411700 [exp] 460 / 1e-158 AT4G27290 800 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125501 [exp] 417 / 9e-144 AT4G27290 709 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G414077 [exp] 418 / 3e-142 AT4G27290 855 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125351 [exp] 416 / 9e-142 AT4G27290 748 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125151 [exp] 415 / 4e-141 AT4G27290 757 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125401 [exp] 413 / 2e-140 AT4G27290 824 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125050 [exp] 375 / 2e-125 AT4G27290 870 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G128800 [exp] 359 / 3e-119 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014813 [exp] 365 / 8e-122 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038554 [exp] 353 / 6e-117 AT4G27290 776 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014812 [exp] 341 / 1e-111 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038553 [exp] 337 / 3e-110 AT4G27290 899 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038556 [exp] 336 / 3e-110 AT4G21380 769 / 0.0 receptor kinase 3 (.1) Lus10038552 [exp] 336 / 3e-110 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014811 [exp] 333 / 2e-109 AT4G27290 808 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037731 [exp] 328 / 2e-109 AT4G27290 644 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018405 [exp] 333 / 4e-109 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10007602 [exp] 331 / 9e-109 AT1G65800 788 / 0.0 receptor kinase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain CL0016 [poplar] [flax] PF11883 [poplar] [flax] DUF3403 Domain of unknown function (DUF3403)
Representative CDS sequence Show only first row Show all	>Potri.011G125201.1 pacid=42781642 polypeptide=Potri.011G125201.1.p locus=Potri.011G125201 ID=Potri.011G125201.1.v4.1 annot-version=v4.1 ATGTTAATATATGAATACATGCCTAACAAAAGTTTGGACTTCTTTATTTTTGACCAGACAAGAAGAAAATTACTGGATTGGAGCAAGTGCATGAACATTA TTGTTGGAATTGCTCGAGGGCTTCTTTATCTCCACCAAGACTCCAGGCTGAGAATAATCCATAGAGATATCAAAGCCAGCAACATTTTACTAGATAATGA GCTAAACCCAAAAATTTCAGACTTTGGCCTTGCTAGAATGTTTCGTGGAGATCAAACGGAGGCCAATACTCATAGGGTGGTTGGAACATATGGCTACATG TCTCCTGAGTATGCATCAAATGGACACTTATCTGTGAAAACCGATGTCTTTAGCTTTGGTGTCCTAGTCCTGGAGATAGTGAGTGGAAACAAAAACAGGG GATTTCGTCACCCGGACCAGACCCTCAACCTTCTTGGGCATGCATGGATACTTTGGATTAAAGGGACACCCTTGGAATTGATCGATGAATGCTTGGCCAA CTCTAGCAATGTGTCTGAAGTGCTAAGATGCATTCATGTGGCTTTATTATGTGTGCAACAACGACCCGAAGATAGGCCAAACATGCCGACTATTGTTCAA ATATTAGGCAATGAGAATCCATTGCCTCAGCCTAAACAGCCTGGATTTTTCATCGGAAGAAACCCACTTGAGCAGGATACTTCATCTAACCGGAACAATG TTTACTCAGCAAATGAAGCTAGTTTGACATCATTAGAGGCACGGTAA
AA sequence Show only first row Show all	>Potri.011G125201.1 pacid=42781642 polypeptide=Potri.011G125201.1.p locus=Potri.011G125201 ID=Potri.011G125201.1.v4.1 annot-version=v4.1 MLIYEYMPNKSLDFFIFDQTRRKLLDWSKCMNIIVGIARGLLYLHQDSRLRIIHRDIKASNILLDNELNPKISDFGLARMFRGDQTEANTHRVVGTYGYM SPEYASNGHLSVKTDVFSFGVLVLEIVSGNKNRGFRHPDQTLNLLGHAWILWIKGTPLELIDECLANSSNVSEVLRCIHVALLCVQQRPEDRPNMPTIVQ ILGNENPLPQPKQPGFFIGRNPLEQDTSSNRNNVYSANEASLTSLEAR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27300			S-locus lectin protein kinase ...		Potri.011G125201 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125301 [exp]	1.00	0.9776
AT1G53430			Leucine-rich repeat transmembr...		Potri.001G385750 [exp]	2.44	0.8727
AT1G03670			ankyrin repeat family protein ...		Potri.018G078200 [exp]	2.82	0.9005
AT4G27290			S-locus lectin protein kinase ...		Potri.011G128650 [exp]	5.65	0.8223
AT3G14470			NB-ARC domain-containing disea...		Potri.017G140132 [exp]	6.48	0.8512
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G118800 [exp]	8.36	0.8398
AT5G36930			Disease resistance protein (TI...		Potri.001G066500 [exp]	10.09	0.8514
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Potri.005G083400 [exp]	11.48	0.8006
AT5G57850			D-aminoacid aminotransferase-l...		Potri.018G039000 [exp]	12.24	0.8225
AT1G55730		ATCAX5	cation exchanger 5 (.1.2)		Potri.010G249200 [exp]	16.24	0.8152

Compare expression of checked genes

Potri.011G125201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.