Potri.011G126051 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G126051.1 pacid=42781271 polypeptide=Potri.011G126051.1.p locus=Potri.011G126051 ID=Potri.011G126051.1.v4.1 annot-version=v4.1
ATGGTATTTTCTCTGCCTCAACTTCCTACCTTATCAGTTGATAAAGTGGAAACTAAGACTTCTACCGGGCCGAGCACTAAGGAGTTCAAAGATGTTTTCT
CTAATTTGGCTCTTAGTCGTAATCCTTTTGATTTTCCACTCCTAACAGATAAAGAGAGGCAACTTATGAAGGATATGATGAGAGGAAAAATAGGCTTCAT
AGAGGCTGATCTTGAGGTGGATAGAGTGTTGGAGAAAGTCTTTACCGTCCCGTCAGACATCTTCGAGATGTCTGATGAAAACTTCCACCACTATTTGGCT
TTAACTGGCGAGATAATTTTTAATCTAAGGAATTCTCCTGTTTCTTTTTATTTCTGA
AA sequence
>Potri.011G126051.1 pacid=42781271 polypeptide=Potri.011G126051.1.p locus=Potri.011G126051 ID=Potri.011G126051.1.v4.1 annot-version=v4.1
MVFSLPQLPTLSVDKVETKTSTGPSTKEFKDVFSNLALSRNPFDFPLLTDKERQLMKDMMRGKIGFIEADLEVDRVLEKVFTVPSDIFEMSDENFHHYLA
LTGEIIFNLRNSPVSFYF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.011G126051 0 1
AT4G08250 GRAS GRAS family transcription fact... Potri.019G007100 11.26 0.8761
AT5G06720 ATPA2 peroxidase 2 (.1) Potri.003G215001 12.80 0.8611
Potri.015G120600 15.77 0.8599
Potri.006G125032 15.81 0.8145
AT3G25810 Terpenoid cyclases/Protein pre... Potri.001G308200 15.87 0.8596
AT3G25830 ATTPS-CIN "terpene synthase-like sequenc... Potri.001G308300 18.57 0.8508
Potri.015G120500 26.60 0.8381
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Potri.005G181500 31.14 0.8326
AT1G71695 Peroxidase superfamily protein... Potri.002G065300 32.17 0.8280
AT5G62280 Protein of unknown function (D... Potri.015G130500 35.69 0.8378

Potri.011G126051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.