Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27290 224 / 1e-68 S-locus lectin protein kinase family protein (.1) AT3G12000 177 / 4e-53 S-locus related protein SLR1, putative (S1) (.1) AT4G21380 182 / 7e-53 ARK3 receptor kinase 3 (.1) AT1G11300 174 / 2e-49 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT1G11410 171 / 6e-49 S-locus lectin protein kinase family protein (.1) AT1G11340 171 / 7e-49 S-locus lectin protein kinase family protein (.1) AT1G11330 171 / 1e-48 S-locus lectin protein kinase family protein (.1.2) AT1G11350 168 / 7e-48 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) AT4G21390 165 / 1e-46 B120 S-locus lectin protein kinase family protein (.1) AT1G65790 159 / 2e-44 ARK1 receptor kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G126201 [exp] 438 / 3e-150 AT4G27290 833 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G412454 [exp] 355 / 3e-124 AT4G27290 316 / 9e-102 S-locus lectin protein kinase family protein (.1) Potri.011G125901 [exp] 353 / 6e-117 AT4G27290 840 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G025601 [exp] 332 / 2e-116 AT4G27290 234 / 2e-72 S-locus lectin protein kinase family protein (.1) Potri.011G128800 [exp] 349 / 1e-115 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G154400 [exp] 340 / 1e-113 AT4G27290 682 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G017800 [exp] 332 / 1e-113 AT4G27290 462 / 1e-156 S-locus lectin protein kinase family protein (.1) Potri.010G025500 [exp] 334 / 6e-113 AT4G27290 472 / 7e-159 S-locus lectin protein kinase family protein (.1) Potri.010G020200 [exp] 329 / 6e-111 AT4G27290 517 / 3e-176 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014808 [exp] 220 / 2e-67 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038557 [exp] 220 / 1e-66 AT4G27290 803 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038556 [exp] 219 / 5e-66 AT4G21380 769 / 0.0 receptor kinase 3 (.1) Lus10014813 [exp] 216 / 3e-65 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038552 [exp] 212 / 1e-63 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014810 [exp] 209 / 7e-63 AT4G27290 692 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014812 [exp] 205 / 6e-61 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037865 [exp] 204 / 9e-61 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014723 [exp] 192 / 2e-60 AT1G11340 255 / 7e-79 S-locus lectin protein kinase family protein (.1) Lus10033365 [exp] 194 / 9e-57 AT4G21380 810 / 0.0 receptor kinase 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [poplar] [flax] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Potri.011G128650.1 pacid=42782350 polypeptide=Potri.011G128650.1.p locus=Potri.011G128650 ID=Potri.011G128650.1.v4.1 annot-version=v4.1 ATGAGAACAACAATGGATCGCATAGCTCCCATATTTCTCTTTTTATTGTTGATTATTGATACATCCACTGCAATTGACACCATAAACACAACTCAATCCA TTAGAGATGGTGATACTATTCTTTCAGCTAATGGAGCCTATGAGTTGGGATTTTTTAGCCCGGGGAATTCTGCAAACCGATACTTGGGGGTATGGTATGC TAAAATATCTGTGATGACTGTAGTTTGGGTTGCCAACAGAGAAACCCCACTTAATGATTCATCAGGTGTTTTAAGGCTTACCAACCAAGGAATTCTCGTC CTTTCAAATCGGAACGGGAGCATAGTTTGGTCTTCCGACTCATCGCGACCTGCGACTAATCCAGCCGCTCAACTTTTGGATTCAGGAAACCTTGTTGTGA AGGAGGAGGGTGATGATAACCTGGAAAGCTCCTTGTGGCAGAGTTTTGAACATCCAGCTGATACATTATTGCCTGAAATGAAGCTAGGACGGAATAGAAT AACAGGGATGGACTCTTACATTACATCCTGGAAGTCACCGGATGATCCTTCAAGAGGTAATGTTTCAGTAATTCTTGTTCCTTATGGATATCCTGAGATA ATTGTGGTGGAGAATTCAATTGTTAAGCACCGGTCTGGACCGTGGAATGGTCTGAGGTTCAGTGGCATGCCTCAATCAAAACCAAATCCCAAATCCCAAA TACTCAATTGA
AA sequence Show only first row Show all	>Potri.011G128650.1 pacid=42782350 polypeptide=Potri.011G128650.1.p locus=Potri.011G128650 ID=Potri.011G128650.1.v4.1 annot-version=v4.1 MRTTMDRIAPIFLFLLLIIDTSTAIDTINTTQSIRDGDTILSANGAYELGFFSPGNSANRYLGVWYAKISVMTVVWVANRETPLNDSSGVLRLTNQGILV LSNRNGSIVWSSDSSRPATNPAAQLLDSGNLVVKEEGDDNLESSLWQSFEHPADTLLPEMKLGRNRITGMDSYITSWKSPDDPSRGNVSVILVPYGYPEI IVVENSIVKHRSGPWNGLRFSGMPQSKPNPKSQILN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27290			S-locus lectin protein kinase ...		Potri.011G128650 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125301 [exp]	3.00	0.8293
AT4G27300			S-locus lectin protein kinase ...		Potri.011G125201 [exp]	5.65	0.8223
AT1G15000		SCPL50	serine carboxypeptidase-like 5...		Potri.008G129800 [exp]	13.22	0.7455
AT3G14470			NB-ARC domain-containing disea...		Potri.017G140132 [exp]	16.61	0.7613
AT1G55730		ATCAX5	cation exchanger 5 (.1.2)		Potri.010G249200 [exp]	19.62	0.7588
AT1G03670			ankyrin repeat family protein ...		Potri.018G078200 [exp]	19.74	0.7729
AT2G34660		EST4, ATMRP2, A...	Arabidopsis thaliana ATP-bindi...		Potri.011G091200 [exp]	26.15	0.7168	MRP1.1
AT1G14780			MAC/Perforin domain-containing...		Potri.010G104600 [exp]	28.91	0.7391
AT5G57850			D-aminoacid aminotransferase-l...		Potri.018G039000 [exp]	28.93	0.7400
AT1G11330			S-locus lectin protein kinase ...		Potri.011G038800 [exp]	38.34	0.7393

Compare expression of checked genes

Potri.011G128650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.