FQR1.2 (Potri.011G129400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol FQR1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27270 342 / 3e-121 Quinone reductase family protein (.1)
AT5G54500 339 / 2e-120 FQR1 flavodoxin-like quinone reductase 1 (.1.2)
AT4G36750 252 / 9e-85 Quinone reductase family protein (.1)
AT5G58800 248 / 4e-84 Quinone reductase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G410700 360 / 1e-128 AT4G27270 345 / 1e-122 Quinone reductase family protein (.1)
Potri.004G028900 327 / 2e-115 AT4G27270 352 / 2e-125 Quinone reductase family protein (.1)
Potri.011G033100 324 / 3e-114 AT4G27270 352 / 1e-125 Quinone reductase family protein (.1)
Potri.009G044400 268 / 4e-92 AT5G58800 322 / 3e-113 Quinone reductase family protein (.1.2)
Potri.007G029600 235 / 1e-78 AT4G36750 362 / 3e-127 Quinone reductase family protein (.1)
Potri.005G126200 235 / 2e-78 AT4G36750 361 / 4e-127 Quinone reductase family protein (.1)
Potri.004G151100 229 / 5e-76 AT4G36750 311 / 4e-107 Quinone reductase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018401 304 / 2e-106 AT4G27270 342 / 3e-121 Quinone reductase family protein (.1)
Lus10006748 297 / 1e-103 AT4G27270 323 / 5e-114 Quinone reductase family protein (.1)
Lus10007612 292 / 7e-101 AT4G27270 329 / 1e-115 Quinone reductase family protein (.1)
Lus10020076 287 / 6e-100 AT4G27270 314 / 2e-110 Quinone reductase family protein (.1)
Lus10041718 247 / 7e-83 AT4G36750 357 / 3e-125 Quinone reductase family protein (.1)
Lus10014325 242 / 3e-81 AT4G36750 370 / 2e-130 Quinone reductase family protein (.1)
Lus10026035 242 / 4e-81 AT4G36750 371 / 4e-131 Quinone reductase family protein (.1)
Lus10005862 239 / 5e-81 AT5G58800 290 / 5e-101 Quinone reductase family protein (.1.2)
Lus10040486 204 / 1e-66 AT4G36750 291 / 6e-100 Quinone reductase family protein (.1)
Lus10024032 171 / 8e-55 AT4G36750 248 / 5e-84 Quinone reductase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0042 Flavoprotein PF03358 FMN_red NADPH-dependent FMN reductase
Representative CDS sequence
>Potri.011G129400.1 pacid=42782287 polypeptide=Potri.011G129400.1.p locus=Potri.011G129400 ID=Potri.011G129400.1.v4.1 annot-version=v4.1
ATGGCAACCAAAGTCTATATTGTGTACTATTCCATGTACGGGCATGTAGAGAAACTGGCAGAAGAGATTAGGAAAGGGGCTTCATCCGTTGAAGGTGTTG
AGGCCAAATTATGGCAGGTTCCTGAGATACTGCCAGAAGAGGTGCTAGGAATGATGAGTGCACCACCAAAGAGTGATGTACCAATCATTACACCTAGTGA
ACTTGCAGAAGCTGATGGCTTTGTGTTTGGATTCCCAACAAGATTTGGAATGATGGCCGCCCAATTCAAAGCTTTTCTGGATGCAACTGGAGGTCTATGG
AAAACACAGCAACTTGCTGGCAAGCCTGCAGGAATGTTCTTTAGCACTGGATCCCAAGGTGGTGGCCAAGAGACCACAGCGTTGACTGCTATTACCCAAC
TCGTTCACCATGGGATGATATTCGTTCCCATTGGCTACACATTCGGTGCTGGCATGTTTGAGATGGAGAAGGTTAAAGGTGGAAGTCCTTATGGTGCAGG
AACTTTTGCTGGGGATGGCTCAAGACAGCCAACCGAGCTTGAACTGGAGCAGGCTTTCCACCAGGGCAAGCACATTGCTGCCATCACAAAGAAGCTCAAG
GGAGCTGCATAA
AA sequence
>Potri.011G129400.1 pacid=42782287 polypeptide=Potri.011G129400.1.p locus=Potri.011G129400 ID=Potri.011G129400.1.v4.1 annot-version=v4.1
MATKVYIVYYSMYGHVEKLAEEIRKGASSVEGVEAKLWQVPEILPEEVLGMMSAPPKSDVPIITPSELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLW
KTQQLAGKPAGMFFSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAAITKKLK
GAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G27270 Quinone reductase family prote... Potri.011G129400 0 1 FQR1.2
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Potri.003G010700 9.05 0.9937
AT5G06740 Concanavalin A-like lectin pro... Potri.004G209300 11.04 0.9923
AT1G78780 pathogenesis-related family pr... Potri.005G188300 12.60 0.9919
Potri.011G005500 20.00 0.9918
AT1G67920 unknown protein Potri.012G044001 23.74 0.9698
Potri.011G005400 24.24 0.9913
AT4G14746 unknown protein Potri.013G039300 26.60 0.9908 Pt-MTN26.2
Potri.001G439900 31.03 0.9909
AT4G15550 IAGLU indole-3-acetate beta-D-glucos... Potri.006G055600 31.93 0.9909 Pt-ZOG1.15
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Potri.001G375166 35.09 0.9909

Potri.011G129400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.