Potri.011G130300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G54580 161 / 1e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
AT2G37510 101 / 5e-28 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
AT1G73530 88 / 2e-22 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
AT5G06210 86 / 7e-22 RNA binding (RRM/RBD/RNP motifs) family protein (.1)
AT3G46020 71 / 1e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
AT3G20930 74 / 5e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
AT5G61030 73 / 8e-16 GR-RBP3 glycine-rich RNA-binding protein 3 (.1)
AT3G26420 72 / 9e-16 ATRZ-1A RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1)
AT1G18630 70 / 1e-15 GR-RBP6 glycine-rich RNA-binding protein 6 (.1)
AT3G23830 69 / 2e-15 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G409800 201 / 2e-67 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Potri.012G038200 92 / 9e-24 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Potri.001G319900 86 / 6e-22 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.006G208500 84 / 4e-21 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1)
Potri.017G059000 83 / 6e-21 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Potri.015G057400 81 / 2e-19 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1)
Potri.008G022280 76 / 2e-18 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Potri.012G061600 78 / 4e-18 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1)
Potri.010G237200 78 / 1e-17 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003593 172 / 3e-53 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Lus10014802 171 / 5e-53 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Lus10003980 103 / 2e-28 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Lus10023758 100 / 4e-27 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Lus10029426 83 / 6e-19 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Lus10021154 79 / 3e-18 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1)
Lus10017852 78 / 5e-18 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1)
Lus10022551 76 / 7e-18 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Lus10034685 78 / 9e-18 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1)
Lus10040519 79 / 1e-17 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0221 RRM PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence
>Potri.011G130300.3 pacid=42780481 polypeptide=Potri.011G130300.3.p locus=Potri.011G130300 ID=Potri.011G130300.3.v4.1 annot-version=v4.1
ATGGCCATGAGAGCAACGACGGCGGCTTTGGCTGCGGCAGCAGCAGCAGCTCCTCGTGGCGGCTTTTTGCGTCTGTTTTCAACAACTTCCACTTCATCCT
CCTCCTTCCCTTTTCCTCAGACCACGCAGCAAACTCCTGCACGTGAACAGGCTGAGCCAAACACCAATCTCTTTGTATCTGGGCTAAGTAAAAGAACAAC
TTCAGAGGGACTACAAGAGGCCTTTTCTAAATTTGGTGAAGTGGTTCAAGCTAGAGTTGTAACTGACAGGGTCTCAGGCTATTCTAAGGGGTTCGGTTTT
GTCAAATATGCTACCTTAGAAGATGCTGCTGAAGGAATAAAAGGCATGGATGGACAGTTTCTGGATGGATGGGTTATATTTGCAGAGTATGCTAGACCCA
GACAACCACCTTCTGAACCTCAAAACAACACAGGCATGGGATTATGGAAACAACGCTACTGA
AA sequence
>Potri.011G130300.3 pacid=42780481 polypeptide=Potri.011G130300.3.p locus=Potri.011G130300 ID=Potri.011G130300.3.v4.1 annot-version=v4.1
MAMRATTAALAAAAAAAPRGGFLRLFSTTSTSSSSFPFPQTTQQTPAREQAEPNTNLFVSGLSKRTTSEGLQEAFSKFGEVVQARVVTDRVSGYSKGFGF
VKYATLEDAAEGIKGMDGQFLDGWVIFAEYARPRQPPSEPQNNTGMGLWKQRY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G54580 RNA-binding (RRM/RBD/RNP motif... Potri.011G130300 0 1
AT4G01310 Ribosomal L5P family protein (... Potri.014G089100 1.00 0.8623 RPL5.2
AT1G10865 unknown protein Potri.010G248800 4.47 0.8115
AT5G39600 unknown protein Potri.004G228566 4.47 0.8481
AT2G20490 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST ... Potri.002G036500 7.14 0.8018
Potri.001G340100 9.94 0.8147
AT2G37020 Translin family protein (.1.2) Potri.006G126200 10.39 0.7929
AT5G64670 Ribosomal protein L18e/L15 sup... Potri.016G002400 11.48 0.8112
AT5G55140 ribosomal protein L30 family p... Potri.014G157400 11.83 0.8234
AT3G04610 FLK flowering locus KH domain, RNA... Potri.013G043000 13.78 0.7825
AT1G03650 Acyl-CoA N-acyltransferases (N... Potri.013G134102 14.56 0.7673

Potri.011G130300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.