Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45560 61 / 4e-12 CYP76C1 "cytochrome P450, family 76, subfamily C, polypeptide 1", cytochrome P450, family 76, subfamily C, polypeptide 1 (.1.2) AT5G57260 60 / 6e-12 CYP71B10 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) AT1G33720 60 / 6e-12 CYP76C6 "cytochrome P450, family 76, subfamily C, polypeptide 6", cytochrome P450, family 76, subfamily C, polypeptide 6 (.1) AT3G26300 60 / 7e-12 CYP71B34 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) AT2G45550 60 / 7e-12 CYP76C4 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) AT2G30770 60 / 9e-12 CYP71A13 cytochrome P450, family 71, subfamily A, polypeptide 13 (.1) AT3G26280 60 / 9e-12 CYP71B4 "cytochrome P450, family 71, subfamily B, polypeptide 4", cytochrome P450, family 71, subfamily B, polypeptide 4 (.1) AT2G45570 59 / 1e-11 CYP76C2 "cytochrome P450, family 76, subfamily C, polypeptide 2", cytochrome P450, family 76, subfamily C, polypeptide 2 (.1) AT3G26180 59 / 1e-11 CYP71B20 "cytochrome P450, family 71, subfamily B, polypeptide 20", cytochrome P450, family 71, subfamily B, polypeptide 20 (.1.2) AT3G26270 59 / 2e-11 CYP71B25 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G131051 [exp] 156 / 4e-48 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.011G130850 [exp] 155 / 1e-46 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130800 [exp] 155 / 2e-46 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074300 [exp] 96 / 1e-24 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074850 [exp] 93 / 1e-23 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074900 [exp] 92 / 3e-23 AT3G26300 383 / 3e-128 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G075000 [exp] 91 / 7e-23 AT3G26300 386 / 2e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G223500 [exp] 85 / 2e-20 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.001G365001 [exp] 80 / 2e-20 AT2G24180 121 / 3e-33 cytochrome p450 71b6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019157 [exp] 89 / 6e-22 AT3G48300 358 / 1e-118 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) Lus10019159 [exp] 87 / 2e-21 AT3G26330 365 / 1e-121 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10041667 [exp] 85 / 2e-20 AT3G26300 375 / 3e-125 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10028926 [exp] 81 / 5e-19 AT3G26330 382 / 3e-127 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10042815 [exp] 80 / 7e-19 AT1G13110 396 / 3e-133 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) Lus10009903 [exp] 80 / 1e-18 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) Lus10013194 [exp] 79 / 1e-18 AT5G25120 387 / 9e-130 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10030708 [exp] 79 / 2e-18 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10026252 [exp] 78 / 3e-18 AT5G25120 383 / 2e-123 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10043362 [exp] 78 / 4e-18 AT3G26330 365 / 3e-121 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.011G130951.1 pacid=42781776 polypeptide=Potri.011G130951.1.p locus=Potri.011G130951 ID=Potri.011G130951.1.v4.1 annot-version=v4.1 ATGTTGCTCTCCCTCCCTGTTTTTTTAACCATCCTTCTCGTTATCTCCATTTTATGGACATGGACGAAACTTATCAAAAGCAACAAGTCAAGTTCAAATC CACCTCCTGGGCCATGGAAATTACCCTTTATTGGAAACCTTCACCAGCTAGTTCACCCTCTGCCCCATCATCGCCTAAGGGACTTGGCCAAGAAATTTGG ACCTGTCATGCAACTTCAAGTTGGTGAAGTTTCCACTGTCATTATTTCTTCATCAGAAGCGGCGAAAGAAGTGATGTCAACTTTGTTGAAAGACCTCATC TCCTAG
AA sequence Show only first row Show all	>Potri.011G130951.1 pacid=42781776 polypeptide=Potri.011G130951.1.p locus=Potri.011G130951 ID=Potri.011G130951.1.v4.1 annot-version=v4.1 MLLSLPVFLTILLVISILWTWTKLIKSNKSSSNPPPGPWKLPFIGNLHQLVHPLPHHRLRDLAKKFGPVMQLQVGEVSTVIISSSEAAKEVMSTLLKDLI S

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45560		CYP76C1	"cytochrome P450, family 76, s...		Potri.011G130951 [exp]	0	1
AT4G01250	WRKY	ATWRKY22, WRKY2...	WRKY family transcription fact...		Potri.001G099001 [exp]	3.16	0.8979
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.005G032700 [exp]	8.36	0.8961
AT1G02400		ATGA2OX4, ATGA2...	DOWNSTREAM TARGET OF AGL15 1, ...		Potri.002G191900 [exp]	10.58	0.8875	GA2.6
AT3G52450		PUB22	plant U-box 22 (.1)		Potri.006G202600 [exp]	13.07	0.8938
AT5G09360		LAC14	laccase 14 (.1)		Potri.019G088600 [exp]	14.31	0.8795
AT2G14960		GH3.1	Auxin-responsive GH3 family pr...		Potri.009G092900 [exp]	15.68	0.8770
AT5G35370			S-locus lectin protein kinase ...		Potri.019G013797 [exp]	23.68	0.8696
AT5G09360		LAC14	laccase 14 (.1)		Potri.019G088700 [exp]	26.66	0.8735
AT4G37160		SKS15	SKU5 similar 15 (.1)		Potri.007G038200 [exp]	27.85	0.8762
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.005G032600 [exp]	33.13	0.8628

Compare expression of checked genes

Potri.011G130951 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.