Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25180 230 / 3e-72 CYP71B14 "cytochrome P450, family 71, subfamily B, polypeptide 14", cytochrome P450, family 71, subfamily B, polypeptide 14 (.1) AT3G26230 230 / 4e-72 CYP71B24 "cytochrome P450, family 71, subfamily B, polypeptide 24", cytochrome P450, family 71, subfamily B, polypeptide 24 (.1) AT3G26300 224 / 1e-69 CYP71B34 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) AT5G57260 223 / 1e-69 CYP71B10 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) AT3G26270 222 / 6e-69 CYP71B25 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) AT1G13080 218 / 7e-69 CYP71B2 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) AT3G26280 221 / 1e-68 CYP71B4 "cytochrome P450, family 71, subfamily B, polypeptide 4", cytochrome P450, family 71, subfamily B, polypeptide 4 (.1) AT3G26320 219 / 6e-68 CYP71B36 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) AT3G26330 218 / 1e-67 CYP71B37 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) AT5G25120 216 / 7e-67 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G130800 [exp] 563 / 0 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130850 [exp] 560 / 0 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074300 [exp] 387 / 3e-133 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G075000 [exp] 385 / 1e-132 AT3G26300 386 / 2e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074900 [exp] 385 / 2e-132 AT3G26300 383 / 3e-128 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074850 [exp] 378 / 1e-129 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G223500 [exp] 337 / 1e-113 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.015G028000 [exp] 335 / 9e-113 AT1G13080 326 / 3e-106 "cytochrome P450, family 71, subfamily B, polypeptide 2", cytochrome P450, family 71, subfamily B, polypeptide 2 (.1.2) Potri.001G364900 [exp] 327 / 3e-112 AT3G26300 228 / 1e-70 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016601 [exp] 344 / 2e-116 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) Lus10009903 [exp] 308 / 3e-102 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) Lus10030924 [exp] 306 / 2e-101 AT3G26300 391 / 2e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10002661 [exp] 304 / 3e-101 AT3G26300 323 / 2e-105 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10013194 [exp] 303 / 2e-100 AT5G25120 387 / 9e-130 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10030708 [exp] 303 / 4e-100 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10004907 [exp] 301 / 4e-100 AT3G26330 330 / 2e-108 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10034397 [exp] 295 / 4e-100 AT3G26230 249 / 2e-79 "cytochrome P450, family 71, subfamily B, polypeptide 24", cytochrome P450, family 71, subfamily B, polypeptide 24 (.1) Lus10029035 [exp] 301 / 4e-99 AT1G13110 402 / 1e-135 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) Lus10010545 [exp] 299 / 4e-99 AT3G26330 321 / 8e-105 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.011G131001.1 pacid=42780466 polypeptide=Potri.011G131001.1.p locus=Potri.011G131001 ID=Potri.011G131001.1.v4.1 annot-version=v4.1 ATGATAGATATATTCCCTTCCTCCAAATTTATTTACATGGTCAGTCGGGTCAGGTCTAGACTCGAAAGGATGCATAGAGAAGCAGATGAGATACTTGAAA GCATCATCTCCGAGCGTAGAGCCAACTCCGCTTTAGCGTCAAAGATGGACAAGAACGAAGAGGATGATCTTCTCGGTGTTCTTTTGAATCTCCAAGACCA TGGAAACCTTGAATTCCAATTAACAACAAGCGCTATCAAAGCTATCATCCTGGGAATGTTCAGCGGTGGAGGTGACACTTCGTCAACAGCTTTAGAGTGG GCAATGTCAGAATTGGTAAAGAACCCGAGAGTAATGGAAAAGGCACAAAAAGAAGTGAGACAAGTCTTCAATGATATTGGAACTATTCCTGACGAAGCAA GCCTTCATGATTTAAAATTCTTGAAGTTGATTATCAAAGAAACTCTAAGATTACATCCTTCTGGACCATTGATTCCAAGAGAGTGTAGGAAGAGATGTAA TGTTAATGGATACGACATCCACGTCAAAAGTAAAGTATTGATTAACGCATGGGCAATTGGAAGAGATCCTAATTATTGGAATGAACCTGAGAGATTCTAT CCAGACAGATTCATCAATGTTTCGACTGATTTTAAGGGTAGCGACTTCGAATTCATCCCATTTGGTGCTGGAAAGAGGATGTGCCCTGGCATGTTGTTTG CTATAGCCAACATTGAGTTTCCACTTGCGCAGATGTTATACCATTTTGACTGGAAACCTGCTGATGGATTGAAACCTGAAGATCTTGACATGACTGAGTC TCTTGGTGGCACAGTTAAGAGAAAACGAGATCTTAAGTTAATTCCCATTTCATATCGTTCACTCGTGGGATAA
AA sequence Show only first row Show all	>Potri.011G131001.1 pacid=42780466 polypeptide=Potri.011G131001.1.p locus=Potri.011G131001 ID=Potri.011G131001.1.v4.1 annot-version=v4.1 MIDIFPSSKFIYMVSRVRSRLERMHREADEILESIISERRANSALASKMDKNEEDDLLGVLLNLQDHGNLEFQLTTSAIKAIILGMFSGGGDTSSTALEW AMSELVKNPRVMEKAQKEVRQVFNDIGTIPDEASLHDLKFLKLIIKETLRLHPSGPLIPRECRKRCNVNGYDIHVKSKVLINAWAIGRDPNYWNEPERFY PDRFINVSTDFKGSDFEFIPFGAGKRMCPGMLFAIANIEFPLAQMLYHFDWKPADGLKPEDLDMTESLGGTVKRKRDLKLIPISYRSLVG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Potri.011G131001 [exp]	0	1
AT3G07600			Heavy metal transport/detoxifi...		Potri.009G048400 [exp]	3.87	0.9812
					Potri.003G071050 [exp]	4.00	0.9819
AT4G08250	GRAS		GRAS family transcription fact...		Potri.005G190300 [exp]	5.19	0.9789	GRAS43
AT1G11050			Protein kinase superfamily pro...		Potri.005G181800 [exp]	5.47	0.9818
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Potri.008G166700 [exp]	5.65	0.9816
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G046700 [exp]	6.00	0.9835
					Potri.002G021100 [exp]	6.24	0.9709
AT1G53903			Protein of unknown function (D...		Potri.001G163400 [exp]	6.48	0.9810
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Potri.005G095250 [exp]	7.93	0.9809
AT1G43040			SAUR-like auxin-responsive pro...		Potri.002G000600 [exp]	8.48	0.9801

Compare expression of checked genes

Potri.011G131001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.