Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	HTA901
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G51060 200 / 1e-67 HTA10 histone H2A 10 (.1) AT5G54640 199 / 2e-67 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1) AT4G27230 197 / 1e-66 HTA2 histone H2A 2 (.1.2) AT3G20670 193 / 1e-64 HTA13 histone H2A 13 (.1) AT1G54690 166 / 4e-54 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) AT1G08880 165 / 1e-53 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) AT5G59870 136 / 4e-42 HTA6 histone H2A 6 (.1) AT5G02560 132 / 2e-40 HTA12 histone H2A 12 (.1.2) AT5G27670 131 / 5e-40 HTA7 histone H2A 7 (.1) AT2G38810 91 / 2e-24 HTA8 histone H2A 8 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G415700 [exp] 202 / 5e-68 AT1G51060 174 / 1e-56 histone H2A 10 (.1) Potri.004G031300 [exp] 187 / 1e-62 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028900 [exp] 164 / 2e-53 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040800 [exp] 164 / 3e-53 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040700 [exp] 159 / 3e-51 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028800 [exp] 151 / 6e-48 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.006G082300 [exp] 136 / 4e-42 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2) Potri.005G026500 [exp] 135 / 1e-41 AT5G27670 145 / 2e-45 histone H2A 7 (.1) Potri.013G018200 [exp] 131 / 3e-40 AT5G27670 160 / 4e-51 histone H2A 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042960 [exp] 201 / 7e-68 AT1G51060 243 / 2e-84 histone H2A 10 (.1) Lus10032464 [exp] 199 / 3e-67 AT1G51060 240 / 2e-83 histone H2A 10 (.1) Lus10039691 [exp] 171 / 9e-56 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10027154 [exp] 171 / 9e-56 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10002253 [exp] 165 / 2e-53 AT1G54690 244 / 9e-85 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10003750 [exp] 157 / 2e-50 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10028044 [exp] 154 / 4e-49 AT1G08880 238 / 4e-82 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Lus10005444 [exp] 137 / 2e-42 AT5G02560 234 / 2e-80 histone H2A 12 (.1.2) Lus10004945 [exp] 137 / 2e-42 AT5G02560 233 / 5e-80 histone H2A 12 (.1.2) Lus10023754 [exp] 136 / 1e-41 AT5G02560 233 / 2e-79 histone H2A 12 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4 CL0012 [poplar] [flax] PF16211 [poplar] [flax] Histone_H2A_C C-terminus of histone H2A
Representative CDS sequence Show only first row Show all	>Potri.011G131400.1 pacid=42781656 polypeptide=Potri.011G131400.1.p locus=Potri.011G131400 ID=Potri.011G131400.1.v4.1 annot-version=v4.1 ATGGCTGGCAGAGGCAAAACCCTAGGATCTGGAACAGCAAAGAAGGCTACATCAAGGAGTAGCAAGGCCGGTCTGCAGTTTCCGGTGGGTCGTATTGCTA GATTCTTGAAGGCCGGCAAGTATGCTGAGCGTGTTGGCGCCGGCGCTCCTGTCTACCTCGCTGCTGTACTTGAATATCTTGCTGCTGAGGTACTTGAATT GGCTGGAAATGCAGCAAGAGACAACAAGAAGACCCGTATTGTGCCACGCCACATCCAGCTAGCAGTGAGGAATGATGAAGAGCTAAGCAAGCTTCTTGGT GATGTTACAATTGCTAACGGAGGTGTGATGCCTAACATCCACAACCTTCTCCTCCCAAAGAAGACTGGTGGCTCCTCCAAGGCCTCAGCTGATGATGACA GTTAA
AA sequence Show only first row Show all	>Potri.011G131400.1 pacid=42781656 polypeptide=Potri.011G131400.1.p locus=Potri.011G131400 ID=Potri.011G131400.1.v4.1 annot-version=v4.1 MAGRGKTLGSGTAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLG DVTIANGGVMPNIHNLLLPKKTGGSSKASADDDS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G51060		HTA10	histone H2A 10 (.1)		Potri.011G131400 [exp]	0	1	HTA901
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Potri.001G130200 [exp]	3.46	0.7834
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Potri.006G110800 [exp]	4.24	0.8110	PAA1.3
AT3G22110		PAC1	20S proteasome alpha subunit C...		Potri.006G008800 [exp]	5.47	0.8195	Pt-PAC1.1
AT4G29830		VIP3	vernalization independence 3, ...		Potri.006G145800 [exp]	5.74	0.8070
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Potri.001G334600 [exp]	6.16	0.7346
AT5G65430		14-3-3KAPPA, GF...	14-3-3 PROTEIN G-BOX FACTOR14 ...		Potri.005G157700 [exp]	12.00	0.7372	VF14.2
AT2G27970		CKS2	CDK-subunit 2 (.1)		Potri.004G217500 [exp]	12.40	0.7653
AT1G07790		HTB1	Histone superfamily protein (....		Potri.008G029900 [exp]	13.85	0.7131
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Potri.001G450900 [exp]	16.24	0.7106
AT1G49410		TOM6	translocase of the outer mitoc...		Potri.009G110100 [exp]	18.33	0.7653

Compare expression of checked genes

Potri.011G131400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.