Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03500 67 / 2e-13 Ankyrin repeat family protein (.1) AT4G03440 64 / 3e-12 Ankyrin repeat family protein (.1) AT4G03450 62 / 2e-11 Ankyrin repeat family protein (.1) AT4G03480 59 / 9e-11 Ankyrin repeat family protein (.1) AT4G14390 56 / 1e-09 Ankyrin repeat family protein (.1) AT4G05040 56 / 1e-09 ankyrin repeat family protein (.1.2.3.4.5) AT1G03670 56 / 1e-09 ankyrin repeat family protein (.1) AT4G03460 56 / 1e-09 Ankyrin repeat family protein (.1) AT5G04730 47 / 1e-06 Ankyrin-repeat containing protein (.1) AT4G03470 45 / 7e-06 Ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G133300 [exp] 284 / 2e-94 AT1G03670 250 / 6e-75 ankyrin repeat family protein (.1) Potri.011G133400 [exp] 266 / 3e-87 AT4G03500 251 / 3e-75 Ankyrin repeat family protein (.1) Potri.019G108000 [exp] 77 / 9e-17 AT4G03500 126 / 3e-30 Ankyrin repeat family protein (.1) Potri.019G108200 [exp] 71 / 1e-14 AT4G03500 114 / 2e-26 Ankyrin repeat family protein (.1) Potri.019G106000 [exp] 70 / 2e-14 AT4G03460 109 / 8e-25 Ankyrin repeat family protein (.1) Potri.019G107000 [exp] 66 / 7e-13 AT4G03500 140 / 5e-35 Ankyrin repeat family protein (.1) Potri.019G107700 [exp] 66 / 8e-13 AT4G03500 129 / 2e-31 Ankyrin repeat family protein (.1) Potri.019G109150 [exp] 64 / 1e-12 AT4G03500 83 / 1e-16 Ankyrin repeat family protein (.1) Potri.019G106300 [exp] 64 / 2e-12 AT4G03500 100 / 2e-22 Ankyrin repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026590 [exp] 54 / 3e-09 AT1G34050 52 / 6e-08 Ankyrin repeat family protein (.1) Lus10038357 [exp] 46 / 5e-06 AT3G54070 389 / 2e-126 Ankyrin repeat family protein (.1) Lus10024844 [exp] 46 / 5e-06 AT1G34050 353 / 4e-114 Ankyrin repeat family protein (.1) Lus10024845 [exp] 44 / 2e-05 AT2G24600 193 / 5e-58 Ankyrin repeat family protein (.1.2.3.4) Lus10018757 [exp] 44 / 3e-05 AT1G34050 298 / 3e-93 Ankyrin repeat family protein (.1) Lus10014031 [exp] 40 / 0.0002 ND 146 / 2e-42 Lus10013878 [exp] 40 / 0.0003 AT1G03670 112 / 4e-27 ankyrin repeat family protein (.1) Lus10034256 [exp] 40 / 0.0006 AT5G51160 140 / 2e-36 Ankyrin repeat family protein (.1) Lus10019887 [exp] 40 / 0.0006 AT5G04700 359 / 3e-113 Ankyrin repeat family protein (.1) Lus10038608 [exp] 39 / 0.001 AT1G10340 168 / 2e-47 Ankyrin repeat family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF13962 [poplar] [flax] PGG Domain of unknown function
Representative CDS sequence Show only first row Show all	>Potri.011G133600.2 pacid=42782411 polypeptide=Potri.011G133600.2.p locus=Potri.011G133600 ID=Potri.011G133600.2.v4.1 annot-version=v4.1 ATGGGAAATACCCTCTTAATGGTAGCAACACTAATCGCAACAGTAACGTTTGCAGCAGCTTTCACACTTCCTGGAGGCTTTAACAATGATCTTGGCCTCA AGCAAGGCGTAGCATTACTCGAATCAAGCAAACATCTGAGATGGTTTGTTTTCTCAGACGCGATTGCCATGACCAGCTCCATAATCGCAGCATGCATAAT TTTTTGGGGAGCTGTTAGTAACGATGAGTCCTATGTTTACTACCTGGCAAGTGCTACCGTGCTAACTTGTATAGCGCTACAATCAGCAGGGATTGCATTC CTGTCAGGAATTGTTGCTGTTTTGCCTGATCAACCCTTTGTTGACAGTGTAACTTATATTGTGGGGATTGCTTTCCATGTTATTAACTTCTTGTTTCTGC TCCAGTTGCTGCGGGTTTTTCTTGTTTCTGAAATCTGCCAGTTCTTGATTTTTTATTTCTGGAAGATGAAGTCCAGAATCAATAAATGA
AA sequence Show only first row Show all	>Potri.011G133600.2 pacid=42782411 polypeptide=Potri.011G133600.2.p locus=Potri.011G133600 ID=Potri.011G133600.2.v4.1 annot-version=v4.1 MGNTLLMVATLIATVTFAAAFTLPGGFNNDLGLKQGVALLESSKHLRWFVFSDAIAMTSSIIAACIIFWGAVSNDESYVYYLASATVLTCIALQSAGIAF LSGIVAVLPDQPFVDSVTYIVGIAFHVINFLFLLQLLRVFLVSEICQFLIFYFWKMKSRINK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G03440			Ankyrin repeat family protein ...		Potri.011G133600 [exp]	0	1
AT2G33060		AtRLP27	receptor like protein 27 (.1)		Potri.010G009400 [exp]	1.00	0.9083
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.010G153800 [exp]	3.46	0.8725
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.007G113800 [exp]	8.94	0.8628
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.003G164000 [exp]	13.22	0.8123
AT5G17620			unknown protein		Potri.013G072300 [exp]	13.56	0.8747
AT5G05800			unknown protein		Potri.008G074066 [exp]	14.83	0.8471
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Potri.001G080000 [exp]	15.16	0.8682
AT3G10740		ATASD1, ARAF1, ...	ARABIDOPSIS THALIANA ALPHA-L-A...		Potri.016G025500 [exp]	18.86	0.7446
AT2G43330		ATINT1	inositol transporter 1 (.1)		Potri.017G032600 [exp]	19.44	0.8354
AT1G28580			GDSL-like Lipase/Acylhydrolase...		Potri.011G064100 [exp]	21.00	0.8043

Compare expression of checked genes

Potri.011G133600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.