Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-NDR1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20600 152 / 2e-46 NDR1 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20590 137 / 5e-40 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20610 114 / 1e-31 non-race specific disease resistance protein, putative (.1) AT5G06320 59 / 1e-10 NHL3 NDR1/HIN1-like 3 (.1) AT4G05220 54 / 1e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 51 / 1e-07 NHL2 NDR1/HIN1-like 2 (.1) AT2G35980 47 / 3e-06 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35460 41 / 0.0002 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G65690 40 / 0.0004 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G418000 [exp] 279 / 2e-96 AT3G20600 144 / 7e-43 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G027400 [exp] 69 / 5e-14 AT4G05220 264 / 8e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023400 [exp] 63 / 2e-12 AT3G20600 59 / 7e-11 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 59 / 2e-10 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 49 / 5e-07 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 48 / 1e-06 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G003800 [exp] 42 / 9e-05 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G148200 [exp] 40 / 0.0007 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043067 [exp] 152 / 3e-46 AT3G20600 154 / 7e-47 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10011162 [exp] 145 / 1e-43 AT3G20600 139 / 3e-41 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 53 / 2e-08 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 52 / 2e-08 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10021286 [exp] 52 / 6e-08 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006754 [exp] 51 / 1e-07 AT4G05220 263 / 3e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018377 [exp] 50 / 7e-07 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10020066 [exp] 49 / 9e-07 AT4G05220 261 / 6e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10000157 [exp] 45 / 8e-06 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 41 / 0.0003 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G133900.1 pacid=42782281 polypeptide=Potri.011G133900.1.p locus=Potri.011G133900 ID=Potri.011G133900.1.v4.1 annot-version=v4.1 ATGCCTGATTCCGGTGGTGGTGGTTGCGGTAGGTGCTGTTGTAACTTCATATTCACTTTAGGGCTAACAGCTCTTTTTATGTGGCTCAGCTTGCGTACTT CATCACCCAATTGTCTACTTAGCAAATTTTACCTTCCTCTTGACCAAACCTCAAACTCTTCAAACCTTACATCCCTTGAGTTTGAACTTACACTTAAAAA CACCAACAAAGACAAGGGTGTGTACTATGATCCAATAAATGTCACATTTTACACTCCAAATAGGTCCCACGTTATTGGGAATTTCACTATAACAAAGTTT TATCAGGGGCATAAAAAGAGTGCTAGAAAGAATGGCACCATATCAAATATTGACAGGGATGTGGTTTCCCAGGCAGCTCCGGCAAATGGGTCGATGGCGC TTTTCCCGGTGGATTTGGCTACTTCAGTGAGGTACAAGATTCTTATGTTCAAGACCAAGAGGTATAAGATAAGGGTGGAGGCTAATGTGGAAGTCATTGC TACCATTATTAAAGTCAACCACAAAGACATAAAGCTCAAGTCTAATGCAGATAAGATTAGGAGCTATTGTGGGCAAATGGGATTTTTTTTTGCTAACCTT TTGGTTTTAGGTTTGCTTATTTTTTGA
AA sequence Show only first row Show all	>Potri.011G133900.1 pacid=42782281 polypeptide=Potri.011G133900.1.p locus=Potri.011G133900 ID=Potri.011G133900.1.v4.1 annot-version=v4.1 MPDSGGGGCGRCCCNFIFTLGLTALFMWLSLRTSSPNCLLSKFYLPLDQTSNSSNLTSLEFELTLKNTNKDKGVYYDPINVTFYTPNRSHVIGNFTITKF YQGHKKSARKNGTISNIDRDVVSQAAPANGSMALFPVDLATSVRYKILMFKTKRYKIRVEANVEVIATIIKVNHKDIKLKSNADKIRSYCGQMGFFFANL LVLGLLIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G20600		NDR1	non race-specific disease resi...		Potri.011G133900 [exp]	0	1	Pt-NDR1.2
AT1G01490			Heavy metal transport/detoxifi...		Potri.017G147400 [exp]	5.29	0.8713
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.011G028400 [exp]	5.74	0.8664
AT1G20780		ATPUB44, SAUL1	ARABIDOPSIS THALIANA PLANT U-B...		Potri.010G079200 [exp]	10.77	0.8647
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Potri.017G063300 [exp]	10.95	0.8369
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.016G137900 [exp]	11.40	0.8430
AT1G06800		PLA-I{gamma}1	phospholipase A I gamma 1, alp...		Potri.005G218500 [exp]	12.32	0.8523
					Potri.004G188300 [exp]	13.19	0.8673
AT5G10695			unknown protein		Potri.010G251000 [exp]	13.41	0.8485
AT5G15650		REVERSIBLYGLYCO...	reversibly glycosylated polype...		Potri.004G117800 [exp]	17.32	0.8445
AT1G16670			Protein kinase superfamily pro...		Potri.001G438400 [exp]	17.83	0.8562

Compare expression of checked genes

Potri.011G133900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.