Plant FIBer expression Database

Potri.011G134500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G134400
[exp]
168 / 2e-54 ND /
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Potri.011G134500.1 pacid=42780454 polypeptide=Potri.011G134500.1.p locus=Potri.011G134500 ID=Potri.011G134500.1.v4.1 annot-version=v4.1
ATGGCAAGGTTTTTGACAATAGCAGTTCTAGCTAGCCTTCTCTTGGCACTCATCGCCAATGCCTCTTCTTACAGAACCACCATCACTACCGTGGAGTTTG
ATGATCAGTCCAGCAGGAGTCGATCTGGAGGCTGCCAAGAGAAGATTCGGAGGGTGGACTTGAGCAGTTGTGAGCAATATGTATCCCAAATATCAAGGCC
AAGGTTAGCACTCCGAGGGATCCACCATCGACAGGGTGATCAAGAGCAAGTTCAGCAATGCTGCCAGCAAATAAGGAATGTGGATAGGCAGTGCCAGTGC
GACGCTTTAAGGTCTGTGATCGAGGAGCAAACACAGCACCAACGCCGCCCTGAACAGGAAGAGAGGCAGGAGGTACAGAGGAGGGCAGCCGAAATACAAA
GTCAGTGCAGCTTGCCCGATTGTCAATCCCAATCAATCTGGTTCTAG
AA sequence
>Potri.011G134500.1 pacid=42780454 polypeptide=Potri.011G134500.1.p locus=Potri.011G134500 ID=Potri.011G134500.1.v4.1 annot-version=v4.1
MARFLTIAVLASLLLALIANASSYRTTITTVEFDDQSSRSRSGGCQEKIRRVDLSSCEQYVSQISRPRLALRGIHHRQGDQEQVQQCCQQIRNVDRQCQC
DALRSVIEEQTQHQRRPEQEERQEVQRRAAEIQSQCSLPDCQSQSIWF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.011G134500
[exp]
0 1
Potri.011G134400
[exp]
1.00 0.9548
AT5G55090 MAPKKK15 mitogen-activated protein kina... Potri.003G130000
[exp]
2.44 0.8781
AT5G39110 RmlC-like cupins superfamily p... Potri.009G140400
[exp]
4.00 0.8675
AT3G24060 Plant self-incompatibility pro... Potri.003G175200
[exp]
8.71 0.8786
AT5G16640 Pentatricopeptide repeat (PPR)... Potri.005G097200
[exp]
9.00 0.8165
AT3G13850 AS2 LBD22 LOB domain-containing protein ... Potri.003G039700
[exp]
15.74 0.8529
AT4G34260 AXY8, FUC95A ALTERED XYLOGLUCAN 8, 1,2-alph... Potri.001G298900
[exp]
20.12 0.8409
AT3G05890 RCI2B RARE-COLD-INDUCIBLE 2B, Low te... Potri.005G002250
[exp]
22.73 0.8461
AT3G15220 Protein kinase superfamily pro... Potri.001G397600
[exp]
25.29 0.8462
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Potri.001G080000
[exp]
26.32 0.8506

Potri.011G134500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.