Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-AT2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54740 56 / 2e-10 SESA5 seed storage albumin 5 (.1) AT4G27140 50 / 4e-08 SESA1, AT2S1 seed storage albumin 1 (.1) AT4G27160 50 / 4e-08 SESA3, AT2S3 seed storage albumin 3 (.1) AT4G27150 49 / 1e-07 SESA2, AT2S2 seed storage albumin 2 (.1) AT4G27170 47 / 3e-07 SESA4, AT2S4 seed storage albumin 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040411 [exp] 69 / 3e-15 AT5G54740 59 / 3e-11 seed storage albumin 5 (.1) Lus10040397 [exp] 66 / 2e-14 ND 39 / 5e-04 Lus10031886 [exp] 54 / 1e-09 ND / Lus10040395 [exp] 51 / 2e-08 AT4G27170 60 / 1e-11 seed storage albumin 4 (.1) Lus10023525 [exp] 47 / 2e-07 AT5G54740 39 / 3e-04 seed storage albumin 5 (.1) Lus10040396 [exp] 44 / 6e-06 AT5G54740 62 / 2e-12 seed storage albumin 5 (.1) Lus10040407 [exp] 42 / 2e-05 ND / Lus10023513 [exp] 40 / 0.0002 AT5G54740 60 / 1e-11 seed storage albumin 5 (.1) Lus10031312 [exp] 39 / 0.0004 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF00234 [poplar] [flax] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Potri.011G134600.1 pacid=42781227 polypeptide=Potri.011G134600.1.p locus=Potri.011G134600 ID=Potri.011G134600.1.v4.1 annot-version=v4.1 ATGGCAAAGCTCATCATCTTCGCAGCCATTTTGACAGCCTTTCTCCTCCTAGTTGACGCCTCCATTCACAGTACAACAGTGATCATCGATGAGGAAAACC CCAGTCGATCAGAAGAAGACTGTCGCGACGAGTTGATTAGGGCACAAGATCTCAAGCATTGCCAGGAATATATCATGCAAGAAGCGAGCTCACGGGACGG CCTTGACATTAACCGAAGCGAAGAGGAACGTCTTGACAGGTGCTGTGATCAGCTAAGACAGATGAGATCCACGTGCCGCTGCTATGGCCTCAGGAAGGCT GTTAAGAGTGCGCCAAAGCAGAGGGGTGTCGGACGAATGGATTTTGATGAGGCTGCGAGTGTGGCCAGTAGCCTTCCCGGCGATTGTGGTATTGAACTAG ACAGTTGTGAATTTGGTTCGCCCTACAGAATGTAA
AA sequence Show only first row Show all	>Potri.011G134600.1 pacid=42781227 polypeptide=Potri.011G134600.1.p locus=Potri.011G134600 ID=Potri.011G134600.1.v4.1 annot-version=v4.1 MAKLIIFAAILTAFLLLVDASIHSTTVIIDEENPSRSEEDCRDELIRAQDLKHCQEYIMQEASSRDGLDINRSEEERLDRCCDQLRQMRSTCRCYGLRKA VKSAPKQRGVGRMDFDEAASVASSLPGDCGIELDSCEFGSPYRM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G54740		SESA5	seed storage albumin 5 (.1)		Potri.011G134600 [exp]	0	1	Pt-AT2.1
AT5G04470		SIM	SIAMESE, cyclin-dependent prot...		Potri.010G231700 [exp]	13.49	0.8696
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Potri.002G060900 [exp]	21.90	0.8676
AT1G27330			Ribosome associated membrane p...		Potri.016G008600 [exp]	25.25	0.8350
AT3G06470			GNS1/SUR4 membrane protein fam...		Potri.003G019800 [exp]	26.49	0.8552
AT5G20110			Dynein light chain type 1 fami...		Potri.003G108700 [exp]	34.20	0.8533
					Potri.018G132951 [exp]	36.98	0.8530
AT3G50390			Transducin/WD40 repeat-like su...		Potri.006G239600 [exp]	50.89	0.8490
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Potri.004G018800 [exp]	56.28	0.8475	Pt-CYP77.2
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Potri.010G165700 [exp]	56.77	0.8481
AT4G14930			Survival protein SurE-like pho...		Potri.010G088100 [exp]	70.45	0.8429

Compare expression of checked genes

Potri.011G134600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.