Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27130 213 / 3e-73 Translation initiation factor SUI1 family protein (.1) AT1G54290 213 / 4e-73 Translation initiation factor SUI1 family protein (.1) AT5G54760 211 / 1e-72 Translation initiation factor SUI1 family protein (.1.2.3) AT5G54940 171 / 7e-57 Translation initiation factor SUI1 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G122600 [exp] 219 / 6e-76 AT4G27130 215 / 3e-74 Translation initiation factor SUI1 family protein (.1) Potri.007G122700 [exp] 218 / 2e-75 AT4G27130 217 / 5e-75 Translation initiation factor SUI1 family protein (.1) Potri.001G418600 [exp] 218 / 4e-75 AT1G54290 218 / 2e-75 Translation initiation factor SUI1 family protein (.1) Potri.017G037100 [exp] 189 / 4e-64 AT1G54290 187 / 2e-63 Translation initiation factor SUI1 family protein (.1) Potri.010G151700 [exp] 162 / 2e-53 AT5G54940 170 / 2e-56 Translation initiation factor SUI1 family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039660 [exp] 220 / 7e-76 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10027181 [exp] 220 / 7e-76 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10015124 [exp] 209 / 8e-72 AT4G27130 209 / 8e-72 Translation initiation factor SUI1 family protein (.1) Lus10031550 [exp] 204 / 4e-69 AT4G27130 207 / 2e-70 Translation initiation factor SUI1 family protein (.1) Lus10021532 [exp] 154 / 5e-50 AT5G54940 169 / 9e-56 Translation initiation factor SUI1 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01253 [poplar] [flax] SUI1 Translation initiation factor SUI1
Representative CDS sequence Show only first row Show all	>Potri.011G134700.2 pacid=42780938 polypeptide=Potri.011G134700.2.p locus=Potri.011G134700 ID=Potri.011G134700.2.v4.1 annot-version=v4.1 ATGTCTGATTTCGACGCCCAAACTCCTTCAGCTTATGATCCTTTTGCTGATGCAAATGCCGAGGACTCTGGTGCTGGGACAAAAGATTATGTGCACATTC GTATACAGCAACGCAATGGTAGGAAAAGCTTGACAACTGTGCAAGGTTTGAAAAAAGAATTCAGCTATAACAAGATACTAAAGGACCTCAAGAAAGAGTT CTGCTGTAATGGTACAGTGGTGCAGGACCCTGAATTAGGCCAGGTTATTCAACTTCAAGGTGACCAGCGCAAGAATGTATCGACCTTCCTTGTTCAGGCT GGCATTGTGAAGAAGGAAAGCATTAAAATTCATGGTTTCTAA
AA sequence Show only first row Show all	>Potri.011G134700.2 pacid=42780938 polypeptide=Potri.011G134700.2.p locus=Potri.011G134700 ID=Potri.011G134700.2.v4.1 annot-version=v4.1 MSDFDAQTPSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA GIVKKESIKIHGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27130			Translation initiation factor ...		Potri.011G134700 [exp]	0	1
AT5G51940		NRPE6A, NRPD6A,...	RNA polymerase Rpb6 (.1)		Potri.012G136900 [exp]	2.23	0.9088
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Potri.018G050200 [exp]	2.23	0.8731
AT1G51200			A20/AN1-like zinc finger famil...		Potri.003G205500 [exp]	2.82	0.9006
AT2G39100			RING/U-box superfamily protein...		Potri.008G215200 [exp]	4.47	0.8581
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Potri.016G138900 [exp]	4.58	0.8655
AT1G22270			Trm112p-like protein (.1)		Potri.002G096600 [exp]	4.69	0.8574
AT2G43770			Transducin/WD40 repeat-like su...		Potri.019G096900 [exp]	4.89	0.8932
AT5G06240		EMB2735	embryo defective 2735 (.1)		Potri.016G074700 [exp]	6.00	0.8704
AT1G20950			Phosphofructokinase family pro...		Potri.006G024500 [exp]	8.48	0.8613
AT3G26410		TRM11, AtTRM11	tRNA modification 11, methyltr...		Potri.001G207000 [exp]	8.94	0.8622

Compare expression of checked genes

Potri.011G134700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.