Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42850 176 / 4e-53 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) AT5G36110 162 / 6e-48 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT5G36130 147 / 1e-45 Cytochrome P450 superfamily protein (.1) AT2G29090 152 / 3e-44 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT4G19230 146 / 3e-42 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT5G45340 145 / 1e-41 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT5G05690 120 / 4e-33 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT3G19270 121 / 1e-32 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT4G36380 120 / 2e-32 ROT3 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1) AT3G50660 114 / 4e-30 PSC1, CYP90B1, CLM, SNP2, DWF4, SAV1 SUPPRESSOR OF NPH4 2, SHADE AVOIDANCE 1, PARTIALLY SUPPRESSING COI1 INSENSITIVITY TO JA 1, DWARF 4, CYTOCHROME P450 90B1, CLOMAZONE-RESISTANT, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G425675 [exp] 269 / 1e-90 AT2G42850 246 / 4e-77 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Potri.004G017800 [exp] 233 / 2e-75 AT5G36110 317 / 1e-103 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017633 [exp] 231 / 2e-74 AT5G36110 301 / 3e-97 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001300 [exp] 231 / 2e-74 AT5G36110 332 / 2e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.004G017700 [exp] 231 / 2e-74 AT5G36110 304 / 2e-98 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G001500 [exp] 230 / 5e-74 AT5G36110 331 / 8e-109 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G137950 [exp] 212 / 5e-68 AT5G36110 261 / 7e-83 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.012G115000 [exp] 193 / 1e-59 AT5G36110 295 / 7e-95 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G057901 [exp] 188 / 1e-57 AT5G36110 279 / 2e-88 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040055 [exp] 264 / 3e-87 AT5G36110 318 / 7e-104 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Lus10010940 [exp] 177 / 2e-53 AT2G42850 571 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Lus10035685 [exp] 144 / 3e-41 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10034768 [exp] 139 / 2e-39 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10033308 [exp] 135 / 5e-38 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10040785 [exp] 137 / 1e-37 AT1G07510 1078 / 0.0 FTSH protease 10 (.1) Lus10016515 [exp] 133 / 4e-37 AT2G29090 554 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) Lus10021725 [exp] 130 / 6e-36 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10028297 [exp] 127 / 7e-36 AT5G05690 472 / 2e-168 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10019858 [exp] 127 / 1e-34 AT3G19270 643 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.011G137750.1 pacid=42781292 polypeptide=Potri.011G137750.1.p locus=Potri.011G137750 ID=Potri.011G137750.1.v4.1 annot-version=v4.1 ATGAATTGTATGTTGATTATGGTTATTATTGCAGAACAAGAACAGATTGCGCAGAGCAAGCAGAAGGGGGAGTTGTTAACCTGGGATGACCTTGCTAAGA TGAAGTACTCATGGAGAGTAGCACAGGAAACCTTGAGAATGGTCTCTCCTATCTTTGGTGGCTTCAGGAAAGCCGTGAAAGATATAGAATACGATGGATA CCTTATTCCTAAAGGGTGGCAAATATTCTGGGTTACAAATATGACCCACATGGACAGTAGCATATTTCCAGAATCGTCAAAATTTGATCCAGCAAGATTC AATAACCAAGCTTCAATCCCACCTTACTGCTTTATTCCATTTGGAGGCGGCCCTCGGATATGTCCAGGATACGAGTTTGCAAGGATTGAAACCCTAATTA CAATCCATCATCTTGTAACTCAATTTACATGGAAGTTGCTTGCGGATAATTTTTTCAAAAGGGATCCAATGCCAGTTCCAACTGAAGGACTGCCAATCCA AATCATGCCAAAGACAAACATAACATCCTAG
AA sequence Show only first row Show all	>Potri.011G137750.1 pacid=42781292 polypeptide=Potri.011G137750.1.p locus=Potri.011G137750 ID=Potri.011G137750.1.v4.1 annot-version=v4.1 MNCMLIMVIIAEQEQIAQSKQKGELLTWDDLAKMKYSWRVAQETLRMVSPIFGGFRKAVKDIEYDGYLIPKGWQIFWVTNMTHMDSSIFPESSKFDPARF NNQASIPPYCFIPFGGGPRICPGYEFARIETLITIHHLVTQFTWKLLADNFFKRDPMPVPTEGLPIQIMPKTNITS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G42850		CYP718	"cytochrome P450, family 718",...		Potri.011G137750 [exp]	0	1
					Potri.005G084651 [exp]	16.73	0.9084
					Potri.011G118166 [exp]	18.00	0.8801
AT4G34090			unknown protein		Potri.007G045900 [exp]	21.74	0.9041
AT1G34470			Protein of unknown function (D...		Potri.009G047400 [exp]	22.75	0.8237
					Potri.017G145400 [exp]	24.67	0.8851
AT4G11660	HSF	AT-HSFB2B, HSFB...	HEAT SHOCK TRANSCRIPTION FACTO...		Potri.001G108100 [exp]	32.31	0.8102	Pt-HSF6.1
AT4G10030			alpha/beta-Hydrolases superfam...		Potri.019G074600 [exp]	32.61	0.8799
AT4G16180			unknown protein		Potri.008G104100 [exp]	32.72	0.8476
					Potri.009G085500 [exp]	33.76	0.7465
AT3G05327			Cyclin family protein (.1)		Potri.005G033600 [exp]	35.09	0.8818

Compare expression of checked genes

Potri.011G137750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.