Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50740 129 / 1e-39 Transmembrane proteins 14C (.1) AT3G20510 126 / 8e-39 Transmembrane proteins 14C (.1) AT3G57280 52 / 4e-09 Transmembrane proteins 14C (.1) AT2G26240 44 / 1e-06 Transmembrane proteins 14C (.1) AT3G43520 42 / 3e-05 Transmembrane proteins 14C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G424000 [exp] 162 / 8e-53 AT1G50740 158 / 2e-51 Transmembrane proteins 14C (.1) Potri.003G094300 [exp] 49 / 6e-08 AT3G57280 214 / 3e-70 Transmembrane proteins 14C (.1) Potri.001G139800 [exp] 48 / 2e-07 AT3G57280 172 / 5e-54 Transmembrane proteins 14C (.1) Potri.006G217400 [exp] 39 / 0.0004 AT3G43520 161 / 7e-49 Transmembrane proteins 14C (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008541 [exp] 145 / 2e-46 AT1G50740 178 / 3e-59 Transmembrane proteins 14C (.1) Lus10019624 [exp] 145 / 4e-46 AT1G50740 177 / 8e-59 Transmembrane proteins 14C (.1) Lus10035434 [exp] 47 / 6e-07 AT2G43080 365 / 4e-125 P4H isoform 1 (.1) Lus10011926 [exp] 39 / 0.0004 AT3G43520 166 / 7e-51 Transmembrane proteins 14C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03647 [poplar] [flax] Tmemb_14 Transmembrane proteins 14C
Representative CDS sequence Show only first row Show all	>Potri.011G138100.1 pacid=42781716 polypeptide=Potri.011G138100.1.p locus=Potri.011G138100 ID=Potri.011G138100.1.v4.1 annot-version=v4.1 ATGCATGACTTCTGCTTCACAATCCCATATGGACTGGTTATTGGGATTGGAGGGGTTATTGGATATTTGAGGAAAGGGAGTGTGGCATCATTAGGAGGGG GGGTTGGCACTGGTTTGGTTCTCATCTTTGCTGGATACTTGAGTCTTAAAGCTTTTTCGAAGGGGAAGAATTCATTTCTTGGCTTGGCTATTGAAACTGT TTGTGCAGCCGTACTGACATTTGTGATGGGGCAACGCTATATGCAAACCTCTAAGATAATGCCTGCTGGTATTGTTGCTGGTATCAGTGCTCTCATGACT GTATTTTATCTGTACAAAATTGCAACTGGTGGCAACCACATTCCAGCTAAGGCTGAGTGA
AA sequence Show only first row Show all	>Potri.011G138100.1 pacid=42781716 polypeptide=Potri.011G138100.1.p locus=Potri.011G138100 ID=Potri.011G138100.1.v4.1 annot-version=v4.1 MHDFCFTIPYGLVIGIGGVIGYLRKGSVASLGGGVGTGLVLIFAGYLSLKAFSKGKNSFLGLAIETVCAAVLTFVMGQRYMQTSKIMPAGIVAGISALMT VFYLYKIATGGNHIPAKAE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G50740			Transmembrane proteins 14C (.1...		Potri.011G138100 [exp]	0	1
AT1G50740			Transmembrane proteins 14C (.1...		Potri.001G424000 [exp]	1.41	0.6298
AT5G03460			unknown protein		Potri.006G122600 [exp]	2.23	0.6933
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.001G250400 [exp]	10.53	0.6116	Pt-ATPH1.2
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Potri.014G158300 [exp]	14.28	0.5840	SMT3.2
AT2G16710			Iron-sulphur cluster biosynthe...		Potri.008G020400 [exp]	14.31	0.5732
AT5G63670		SPT42	SPT4 homolog 2 (.1.2)		Potri.010G255000 [exp]	20.34	0.5563
AT2G34450			HMG-box (high mobility group) ...		Potri.004G131400 [exp]	23.91	0.5269
AT5G47310			PPPDE putative thiol peptidase...		Potri.003G080300 [exp]	34.05	0.5582
AT5G04000			unknown protein		Potri.006G047800 [exp]	34.29	0.5634
AT3G43810		CAM7	calmodulin 7 (.1)		Potri.016G024700 [exp]	41.56	0.5062	Pt-CAM6.1

Compare expression of checked genes

Potri.011G138100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.