Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17170 123 / 9e-37 ATGSTU24 Arabidopsis thaliana Glutathione S-transferase \(class tau\) 24, glutathione S-transferase TAU 24 (.1) AT1G78340 122 / 2e-36 ATGSTU22 glutathione S-transferase TAU 22 (.1) AT1G78320 118 / 8e-35 ATGSTU23 glutathione S-transferase TAU 23 (.1) AT1G17180 117 / 1e-34 ATGSTU25 glutathione S-transferase TAU 25 (.1) AT1G78360 116 / 3e-34 ATGSTU21 glutathione S-transferase TAU 21 (.1) AT3G43800 115 / 9e-34 ATGSTU27 glutathione S-transferase tau 27 (.1) AT1G78380 114 / 3e-33 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) AT1G17190 107 / 9e-31 ATGSTU26 glutathione S-transferase tau 26 (.1) AT1G78370 106 / 2e-30 ATGSTU20 glutathione S-transferase TAU 20 (.1) AT2G29420 107 / 3e-30 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G140700 [exp] 150 / 3e-47 AT1G78380 287 / 3e-99 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G436600 [exp] 143 / 1e-44 AT1G78380 318 / 2e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437400 [exp] 142 / 2e-44 AT1G78380 316 / 2e-110 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437200 [exp] 142 / 5e-44 AT1G78380 308 / 2e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437000 [exp] 139 / 5e-43 AT1G78380 308 / 1e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437500 [exp] 137 / 1e-42 AT1G17180 232 / 2e-78 glutathione S-transferase TAU 25 (.1) Potri.001G436800 [exp] 136 / 5e-42 AT1G17180 308 / 2e-107 glutathione S-transferase TAU 25 (.1) Potri.011G140400 [exp] 136 / 6e-42 AT1G78380 308 / 9e-108 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140800 [exp] 134 / 6e-41 AT1G78380 318 / 1e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042468 [exp] 126 / 8e-38 AT1G78380 306 / 6e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10026199 [exp] 129 / 2e-36 AT1G17160 496 / 8e-173 pfkB-like carbohydrate kinase family protein (.1.2) Lus10042469 [exp] 118 / 1e-34 AT1G78380 284 / 5e-98 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10026198 [exp] 115 / 1e-33 AT1G78380 295 / 3e-102 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10005592 [exp] 113 / 8e-33 AT1G17180 271 / 9e-93 glutathione S-transferase TAU 25 (.1) Lus10042470 [exp] 112 / 1e-32 AT1G78380 291 / 1e-100 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10021102 [exp] 104 / 4e-29 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1) Lus10019480 [exp] 103 / 4e-29 AT1G17180 231 / 6e-77 glutathione S-transferase TAU 25 (.1) Lus10040765 [exp] 98 / 2e-28 AT2G29420 116 / 5e-34 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016470 [exp] 100 / 3e-28 AT2G29420 166 / 6e-52 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF02798 [poplar] [flax] GST_N Glutathione S-transferase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.011G140750.1 pacid=42780752 polypeptide=Potri.011G140750.1.p locus=Potri.011G140750 ID=Potri.011G140750.1.v4.1 annot-version=v4.1 ATGGCTGATGAGGTGACACTGTTGAATTTCTGGGCAAGCCCTTTTGGCATGAGAGTCAAAATAGCACTGGCTGAGAAGGAAGTCAAGTATGAGTATAGTG AACAGGACTTGATGAACGGAAAGAGTGATTTGCTTCTGCAGATGAATCCAGTTTACAAGAAGATTCCAGTTCTCATCCACAGAGGAAAACCAGTGTGTGA ATCCCTTATTATTGTTCAGTATATTGATGATGTGTGGAGGGACAAGGCTCGATCCTTTGCTACCTTCTGA
AA sequence Show only first row Show all	>Potri.011G140750.1 pacid=42780752 polypeptide=Potri.011G140750.1.p locus=Potri.011G140750 ID=Potri.011G140750.1.v4.1 annot-version=v4.1 MADEVTLLNFWASPFGMRVKIALAEKEVKYEYSEQDLMNGKSDLLLQMNPVYKKIPVLIHRGKPVCESLIIVQYIDDVWRDKARSFATF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17170		ATGSTU24	Arabidopsis thaliana Glutathio...		Potri.011G140750 [exp]	0	1
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Potri.004G176750 [exp]	2.82	0.9688
AT1G79080			Pentatricopeptide repeat (PPR)...		Potri.001G457300 [exp]	4.47	0.9714
AT5G65380			MATE efflux family protein (.1...		Potri.007G010200 [exp]	4.58	0.9570
AT5G38260			Protein kinase superfamily pro...		Potri.007G125800 [exp]	4.58	0.9586
AT4G16330			2-oxoglutarate (2OG) and Fe(II...		Potri.011G024100 [exp]	6.00	0.9530
AT5G51020		CAA33, CRL	constitutive activator of AAA-...		Potri.012G109800 [exp]	9.16	0.9480
AT4G31390			Protein kinase superfamily pro...		Potri.006G275600 [exp]	9.48	0.9571
AT1G24490		ALB4, ARTEMIS	ARABIDOPSIS THALIANA ENVELOPE ...		Potri.010G051900 [exp]	12.96	0.9521
AT3G19900			unknown protein		Potri.010G169700 [exp]	13.03	0.9502
AT3G56010			unknown protein		Potri.010G186800 [exp]	13.11	0.9583

Compare expression of checked genes

Potri.011G140750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.