Pt-RPL9.4 (Potri.011G147700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPL9.4
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10450 331 / 2e-117 Ribosomal protein L6 family (.1)
AT1G33140 331 / 2e-117 PGY2 PIGGYBACK2, Ribosomal protein L6 family (.1)
AT1G33120 331 / 2e-117 Ribosomal protein L6 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G148700 384 / 2e-138 AT1G33140 330 / 4e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.001G454101 382 / 8e-138 AT1G33140 331 / 1e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.001G453900 382 / 8e-138 AT1G33140 331 / 1e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Potri.001G454000 382 / 2e-137 AT1G33140 331 / 2e-117 PIGGYBACK2, Ribosomal protein L6 family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015588 362 / 2e-129 AT1G33140 350 / 4e-125 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10032962 359 / 2e-128 AT1G33140 345 / 4e-123 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10005286 358 / 4e-128 AT1G33140 347 / 1e-123 PIGGYBACK2, Ribosomal protein L6 family (.1)
Lus10032918 305 / 3e-106 AT1G33140 301 / 9e-105 PIGGYBACK2, Ribosomal protein L6 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00347 Ribosomal_L6 Ribosomal protein L6
Representative CDS sequence
>Potri.011G147700.1 pacid=42780962 polypeptide=Potri.011G147700.1.p locus=Potri.011G147700 ID=Potri.011G147700.1.v4.1 annot-version=v4.1
ATGAAGACCATCCTCTCTTCTGAAACGATGGATATCCCAGATGGGGTTAAGATCAAGATCAATGCCAGAATCATCGAAGTCGAAGGCCCAAGAGGGAAGC
TTACAAGGAACTTCAAGCACTTGAATCTTGATTTTCAGTTGATCAAAGACGAGGAAGGGAAGAGAAAGCTCAAGATCGATGCCTGGTTTGCGTCAAGAAA
GACCAGTGCTGCTATCAGGACAGCCCTTAGCCATGTTGAGAACTTGATTACTGGGGTTACTAAGGGCTACAGATACAAGATGAGGTTTGTGTATGCTCAC
TTTCCCATCAATGCCTCCATCACCAACAGCAATGCTGCCATTGAGATCAGGAACTTTCTTGGCGAGAAGAAGGTGAGGAAGGTTGACATGTTGGAAGGCG
TGTCTATTGTTCGGTCTGAAAAGGTTAAGGATGAACTCGTCCTAGATGGCAACGACATTGAACTTGTCTCCCGGTCTGCTGCTTTGATTAATCAGAAATG
TCATGTGAAGAACAAGGATATCCGCAAATTTCTTGATGGGATCTATGTGAGTGAGAAGGGAACTGTAGTTGAGGAAGAGTGA
AA sequence
>Potri.011G147700.1 pacid=42780962 polypeptide=Potri.011G147700.1.p locus=Potri.011G147700 ID=Potri.011G147700.1.v4.1 annot-version=v4.1
MKTILSSETMDIPDGVKIKINARIIEVEGPRGKLTRNFKHLNLDFQLIKDEEGKRKLKIDAWFASRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAH
FPINASITNSNAAIEIRNFLGEKKVRKVDMLEGVSIVRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYVSEKGTVVEEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G10450 Ribosomal protein L6 family (.... Potri.011G147700 0 1 Pt-RPL9.4
AT5G61170 Ribosomal protein S19e family ... Potri.004G118800 1.00 0.9744 RPS19.1
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Potri.004G196500 1.73 0.9653 Pt-RPL30.1
AT5G27700 Ribosomal protein S21e (.1) Potri.005G026000 2.82 0.9685
AT3G05560 Ribosomal L22e protein family ... Potri.014G128800 3.46 0.9630 RPL22.2
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.011G148700 3.74 0.9540 RPL9.5
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.002G140400 4.24 0.9592 Pt-RPS11.5
AT5G57290 60S acidic ribosomal protein f... Potri.009G032600 4.89 0.9579
AT4G39200 Ribosomal protein S25 family p... Potri.009G118900 5.65 0.9523
AT4G27090 Ribosomal protein L14 (.1) Potri.010G069900 6.92 0.9471
AT4G25740 RNA binding Plectin/S10 domain... Potri.017G146700 7.07 0.9563 RPS10.3

Potri.011G147700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.