Potri.011G149400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33055 66 / 3e-16 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G452500 69 / 9e-18 AT1G33055 49 / 3e-09 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010148 80 / 2e-19 AT4G35580 325 / 9e-105 NAC transcription factor-like 9 (.1.2.3)
PFAM info
Representative CDS sequence
>Potri.011G149400.1 pacid=42782243 polypeptide=Potri.011G149400.1.p locus=Potri.011G149400 ID=Potri.011G149400.1.v4.1 annot-version=v4.1
ATGATACTGGTGGCGATAATGGCGGAGCTGATGGAGGAGTACACGGCGTTGCTGACAAGTGTTTTGGAGCATTTGTTTAACGAGGCACCTTTTCCAAGAA
GGGTTCGTTTTCTCATACTCCATAACCTTCCTTTTGCTTCCTCTGCTCATCCTCCTCTACTTAGACCTCCTAACTAG
AA sequence
>Potri.011G149400.1 pacid=42782243 polypeptide=Potri.011G149400.1.p locus=Potri.011G149400 ID=Potri.011G149400.1.v4.1 annot-version=v4.1
MILVAIMAELMEEYTALLTSVLEHLFNEAPFPRRVRFLILHNLPFASSAHPPLLRPPN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G33055 unknown protein Potri.011G149400 0 1
Potri.001G137100 4.47 0.8428
AT2G27230 bHLH LHW, bHLH156 LONESOME HIGHWAY, transcriptio... Potri.016G101801 7.93 0.8167
Potri.018G119450 8.94 0.8165
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Potri.017G075000 9.16 0.8049
AT1G31170 ATSRX sulfiredoxin (.1.2.3.4) Potri.015G124601 10.48 0.8133
AT4G10265 Wound-responsive family protei... Potri.019G117700 10.48 0.8215
Potri.014G064950 14.07 0.7910
AT4G26270 PFK3 phosphofructokinase 3 (.1) Potri.006G235132 15.00 0.8161
AT5G18020 SAUR-like auxin-responsive pro... Potri.004G166300 16.00 0.7997
AT1G64830 Eukaryotic aspartyl protease f... Potri.018G097801 16.88 0.6338

Potri.011G149400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.