Potri.011G149950 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G452000 139 / 7e-41 AT2G36090 115 / 2e-29 F-box family protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G149950.1 pacid=42780368 polypeptide=Potri.011G149950.1.p locus=Potri.011G149950 ID=Potri.011G149950.1.v4.1 annot-version=v4.1
ATGGTAAACAGTTACAAAAACTGTGATCTCAATGAATGTATAAAATCTGTCAGCCAATGCTTCCCTGGACTCCCTTCTCTTGATTATTTCTCTCTTCTGT
TTCTCATACTTCCTGATTCCCTCTTCCGCTTTAAACTGATTTGTACTGGGCTGGTTGTACAAGGCCCTGTTCAGAATCATCAAACTACTCCATACATTGA
CATGGACATCTTCCATCTTCTCAATTCTCATGCTTATTTCCCTCCATTGCAGGCCCTCTTCTCTTTCTGTCATCTTGAATCTAGTTATCACCATGCATCT
GGCCTGCTTCTGAGACAGAAAACCATCTTCCACAGTATCCGACTCAACTTGAGATCCTCTATAAGCTTCTTGCAATGA
AA sequence
>Potri.011G149950.1 pacid=42780368 polypeptide=Potri.011G149950.1.p locus=Potri.011G149950 ID=Potri.011G149950.1.v4.1 annot-version=v4.1
MVNSYKNCDLNECIKSVSQCFPGLPSLDYFSLLFLILPDSLFRFKLICTGLVVQGPVQNHQTTPYIDMDIFHLLNSHAYFPPLQALFSFCHLESSYHHAS
GLLLRQKTIFHSIRLNLRSSISFLQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.011G149950 0 1
AT5G42690 Protein of unknown function, D... Potri.002G128400 5.65 0.7681
AT4G35590 RKD5 RWP-RK domain-containing 5, RW... Potri.005G101000 7.48 0.7877
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Potri.019G006570 8.12 0.7794
AT1G30760 FAD-binding Berberine family p... Potri.011G161400 8.94 0.8364
AT5G03250 Phototropic-responsive NPH3 fa... Potri.010G223600 15.23 0.7602
AT3G53810 Concanavalin A-like lectin pro... Potri.009G035400 21.56 0.7688
AT3G61420 BSD domain (BTF2-like transcri... Potri.005G061366 21.72 0.8063
AT1G32583 unknown protein Potri.006G017600 32.86 0.7099
AT3G05030 ATNHX2, NHX2 sodium hydrogen exchanger 2 (.... Potri.013G031700 33.49 0.6674 Pt-NHX2.2
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Potri.007G080300 35.24 0.7311

Potri.011G149950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.