Potri.011G150100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10500 485 / 3e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G24530 407 / 2e-142 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G36690 261 / 6e-85 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G44800 244 / 2e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G60290 236 / 4e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G05600 236 / 6e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G38240 227 / 9e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G51240 221 / 1e-69 TT6, F3'H, F3H TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2)
AT3G13610 221 / 2e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G451900 646 / 0 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.014G106700 537 / 0 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451700 524 / 0 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451600 459 / 5e-163 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.012G006300 405 / 9e-142 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.015G002800 405 / 9e-142 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451300 383 / 6e-133 AT4G10500 326 / 1e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150200 378 / 6e-131 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150300 377 / 2e-130 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030185 496 / 9e-178 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10032930 397 / 9e-139 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10015573 392 / 8e-137 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10035782 270 / 2e-88 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10014398 255 / 2e-82 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10024882 252 / 7e-82 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023890 246 / 8e-79 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10000711 240 / 4e-77 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005037 237 / 3e-75 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10041912 228 / 8e-72 AT3G51240 603 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
CL0029 Cupin PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence
>Potri.011G150100.1 pacid=42782441 polypeptide=Potri.011G150100.1.p locus=Potri.011G150100 ID=Potri.011G150100.1.v4.1 annot-version=v4.1
ATGGCTCCCACCGCCAAGCTACTACTAGCCGACCTTGCATCTTCAGGTGTAAAACAAATTCCTTCCAACTTCATCCGTCCCATCTCCGACCGTCCGAATC
TCTCCGATGTTCAGATTTCGGATGGCTCGATTCCTCTAATTGACCTTCGTGGCCTTGATGGTCCCAACCACTCTACTATAATCGAACAAATTGGCCAAGC
ATGCCAAAGGGATGGGTTCTTTCAGGTGAAGAATCATGGGATACCAGAGGAAATGATTAGTATCATACTAAACATAGCTAGACAGTTCTTCAAATTGCCT
GAAAGTGAAAGGTTAAAAAATTACTCTGACGATCCCACTAAGACAACCAGGTTGTCTACTAGTTTCAATATTAAGACAGAACAAGTTTCAAGCTGGAGAG
ATTTCTTGAGACTTCATTGTTATCCTCTCGAAGATTACGTACATGAATGGCCTAGCAATCCTCCATCATTCAGGAAAGATGTGGCTGAATATTGCACAAG
TGTTAGAGGTCTAGTGTTGAGACTGCTTGAGGCCATATCCGAGAGCTTGGGTTTGGAAAGAGACTATATTGATAAGAAATTAGGCGGGCATGGACAACAT
ATGGCTATGAACTACTATCCACCCTGTCCACAGCCAGAACTCACATATGGATTGCCTGGACACACCGACCCTAATTTAATCACCATCCTGTTACAAGATC
ACGTGCCTGGATTGCAGGTTCTAAGAAATGGCAAGTGGATTGCTGTGAATCCGATTCCCAATACTTTCATCGTCAACATCGGTGATCAAATGCAGGTACT
TAGCAATGATCGTTACAAGAGTGTGCTTCACCGAGCAGTTGTGAACAGTGATAAAGACCGAATATCTATACCGACGTTCTACTGTCCTTCACCGGATGCT
GTAATCGGGCCTCCAAAGGAGCTAGTCGACGACGAGCATCCTGCCGTCTATAGAGATTTTACGTACGGTGAATACTATGAGAAGTTTTGGAACAAGGGAC
TTGTAAAAGAATGTTGCTTGGACTTGTTCAAGCCTTCTAATAATACAACCTAG
AA sequence
>Potri.011G150100.1 pacid=42782441 polypeptide=Potri.011G150100.1.p locus=Potri.011G150100 ID=Potri.011G150100.1.v4.1 annot-version=v4.1
MAPTAKLLLADLASSGVKQIPSNFIRPISDRPNLSDVQISDGSIPLIDLRGLDGPNHSTIIEQIGQACQRDGFFQVKNHGIPEEMISIILNIARQFFKLP
ESERLKNYSDDPTKTTRLSTSFNIKTEQVSSWRDFLRLHCYPLEDYVHEWPSNPPSFRKDVAEYCTSVRGLVLRLLEAISESLGLERDYIDKKLGGHGQH
MAMNYYPPCPQPELTYGLPGHTDPNLITILLQDHVPGLQVLRNGKWIAVNPIPNTFIVNIGDQMQVLSNDRYKSVLHRAVVNSDKDRISIPTFYCPSPDA
VIGPPKELVDDEHPAVYRDFTYGEYYEKFWNKGLVKECCLDLFKPSNNTT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G10490 2-oxoglutarate (2OG) and Fe(II... Potri.011G150100 0 1
Potri.008G176201 1.73 0.8790
AT2G24640 UBP19 ubiquitin-specific protease 19... Potri.018G009500 2.82 0.8654
Potri.008G195401 10.95 0.8235
Potri.003G089201 12.96 0.8208
AT1G04560 AWPM-19-like family protein (.... Potri.017G113000 18.41 0.8270
AT5G08710 RUG1 RCC1/UVR8/GEF-like 1, Regulato... Potri.005G071000 18.54 0.7918
AT2G47430 CKI1 CYTOKININ-INDEPENDENT 1, Signa... Potri.013G009700 21.54 0.8250
AT5G63610 HEN3, CDKE;1, C... HUA ENHANCER 3, cyclin-depende... Potri.001G088000 28.10 0.7090 Pt-HEN3.1
AT1G22930 T-complex protein 11 (.1.2) Potri.013G105300 28.93 0.8206
AT2G29500 HSP20-like chaperones superfam... Potri.004G187202 30.98 0.8231

Potri.011G150100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.