Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10500 328 / 3e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 326 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 262 / 2e-85 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 207 / 4e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G08640 192 / 2e-58 ATFLS1, FLS flavonol synthase 1 (.1.2) AT2G44800 189 / 6e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G60290 183 / 1e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 174 / 4e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 169 / 2e-49 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 169 / 7e-49 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G451300 [exp] 625 / 0 AT4G10500 326 / 1e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150200 [exp] 481 / 2e-171 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451500 [exp] 477 / 6e-170 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G164200 [exp] 424 / 3e-149 AT4G10500 305 / 4e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150400 [exp] 424 / 3e-149 AT4G10500 305 / 4e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G151000 [exp] 419 / 2e-147 AT4G10500 287 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 379 / 2e-131 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 377 / 1e-130 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451600 [exp] 366 / 2e-126 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030185 [exp] 327 / 8e-111 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 262 / 1e-85 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 259 / 2e-84 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 207 / 3e-64 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 198 / 3e-60 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 196 / 2e-59 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 187 / 2e-56 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 179 / 2e-53 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032502 [exp] 177 / 2e-52 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10021943 [exp] 172 / 4e-50 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.011G150300.1 pacid=42781411 polypeptide=Potri.011G150300.1.p locus=Potri.011G150300 ID=Potri.011G150300.1.v4.1 annot-version=v4.1 ATGTCGGCCACTATGTTGCAAGTAGCTGAAGGCCTCCTTGCTTTGCCAGGAGCCAAGCATCTTCCACACACCTATAAGGATCCCATTTCCAATCTTCCAA CCCTCCCTGAGGCTCAGGTATCTGATAGCTCCATCCCCATCATTGACCTGGAAGCCCTTCATGGTCCTCGCCGCTCCGATATTGTCAAACAACTTGGCCA GGCATGCCAGCACAGAGGTTTCTTTGCGGTGAAGAATCATGGAATTCCAAGGACAGCGGTTAGCAACATATTCGACACAACAAGAGAATTCTTTCATCTG CCAAAGGAAGAAAGAATGAAATTCTACACTCCTGACCCTAACAGTGACATCAGGCTAATGAATGCTTATAAAGATGAGGTTGCAAATGTCTTTGTAGCAA GGGAATCTTTGAAGTTCCATTGCCACCCTGTTGAAAATTACGTGAATAAGTGGCCAACAAATCCTCCTTCCTTCAGGAAGTATGCCGCCGAGTATTTGAC AAATGTGAGGAGGGTGGAGATAACACTACTTGGTGCAATATCAGAGAGCTTAGGCCTGGAAAGAGATTATATAGAGAAGAAATTGGGTGGACATTATGCA TCTTTGAACTACTACGGAGCTTGTGAACAATCAGATCTCGAGCTTACTTATGGAGTGCGTGCGCATACTGATCCAACTATAATAACTATTCTATTGCAAG ATGATGTGCCTGGACTTCAGGTTCTAAGTGAGGACAAATGGATGGATGTCAATCCCATTCCAGGCACAGTGGTTGTCCATGTTGGAGATCTGCTGCAGGC AATTAGCAATCATAAATTCAAGAGTTTGCTCCATCAAGCTATGGTGAATTGTGAGAAGGAGCGTATGTCCATCGCCTCGTATTGCTATCCATCATCTGAT GCCATGATTGGACCTCCTAAGAAGTTGATAGACAATGATCATCCTGCTGTCTATAAAGATTTCACGTTTAAAGAATTCAGTGAGCAAATGTGGAAAGTAA TAACTTTTACTGATACGCGTTTGGACTCGTTCAAGTGTTCTACTGCCTGA
AA sequence Show only first row Show all	>Potri.011G150300.1 pacid=42781411 polypeptide=Potri.011G150300.1.p locus=Potri.011G150300 ID=Potri.011G150300.1.v4.1 annot-version=v4.1 MSATMLQVAEGLLALPGAKHLPHTYKDPISNLPTLPEAQVSDSSIPIIDLEALHGPRRSDIVKQLGQACQHRGFFAVKNHGIPRTAVSNIFDTTREFFHL PKEERMKFYTPDPNSDIRLMNAYKDEVANVFVARESLKFHCHPVENYVNKWPTNPPSFRKYAAEYLTNVRRVEITLLGAISESLGLERDYIEKKLGGHYA SLNYYGACEQSDLELTYGVRAHTDPTIITILLQDDVPGLQVLSEDKWMDVNPIPGTVVVHVGDLLQAISNHKFKSLLHQAMVNCEKERMSIASYCYPSSD AMIGPPKKLIDNDHPAVYKDFTFKEFSEQMWKVITFTDTRLDSFKCSTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.011G150300 [exp]	0	1
AT5G66820			unknown protein		Potri.007G041300 [exp]	16.49	0.7498
AT4G17900			PLATZ transcription factor fam...		Potri.019G051200 [exp]	17.23	0.7337
AT4G13540			unknown protein		Potri.010G062600 [exp]	20.00	0.7241
AT3G09590			CAP (Cysteine-rich secretory p...		Potri.016G082000 [exp]	23.32	0.6295
AT5G60680			Protein of unknown function, D...		Potri.004G211100 [exp]	23.87	0.7225
AT1G01840			unknown protein		Potri.014G077000 [exp]	47.91	0.6901
AT3G60410			Protein of unknown function (D...		Potri.014G044800 [exp]	48.37	0.6636
AT5G54390		ATAHL, AHL	HAL2-like (.1)		Potri.004G036400 [exp]	56.85	0.6963
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Potri.005G190700 [exp]	59.03	0.6744
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Potri.012G089900 [exp]	64.06	0.6907	CYP71AP2v1

Compare expression of checked genes

Potri.011G150300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.