Potri.011G150800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61460 69 / 6e-15 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT3G43430 67 / 4e-14 RING/U-box superfamily protein (.1)
AT4G11360 63 / 8e-13 RHA1B RING-H2 finger A1B (.1)
AT5G41400 63 / 2e-12 RING/U-box superfamily protein (.1)
AT4G11370 61 / 5e-12 RHA1A RING-H2 finger A1A (.1)
AT2G42350 62 / 7e-12 RING/U-box superfamily protein (.1)
AT5G20885 61 / 8e-12 RING/U-box superfamily protein (.1)
AT1G63840 59 / 2e-11 RING/U-box superfamily protein (.1)
AT2G01150 59 / 3e-11 RHA2B RING-H2 finger protein 2B (.1)
AT4G40070 60 / 7e-11 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G450700 202 / 5e-67 AT3G61460 71 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.003G130900 73 / 2e-16 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.001G101000 72 / 7e-16 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1)
Potri.014G087700 70 / 2e-15 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.002G161900 66 / 9e-14 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.007G086300 64 / 4e-13 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.010G133300 63 / 5e-13 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.010G133200 63 / 5e-13 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1)
Potri.006G217000 62 / 4e-12 AT5G20885 138 / 8e-42 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008283 99 / 4e-26 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10017510 73 / 3e-16 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10028773 71 / 1e-15 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10032290 71 / 2e-15 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 71 / 2e-15 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10036378 69 / 2e-14 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10019507 59 / 4e-11 AT5G20885 162 / 5e-51 RING/U-box superfamily protein (.1)
Lus10043353 59 / 9e-11 AT5G20885 157 / 4e-49 RING/U-box superfamily protein (.1)
Lus10023617 58 / 4e-10 AT5G05810 219 / 1e-68 RING/U-box superfamily protein (.1)
Lus10031515 58 / 4e-10 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.011G150800.1 pacid=42780789 polypeptide=Potri.011G150800.1.p locus=Potri.011G150800 ID=Potri.011G150800.1.v4.1 annot-version=v4.1
ATGGGGATCTCCTTTGTTGCAGTGAAGATGCCAAAATGTTTTGGTCTCCAATTTCTTCTAGAGTTCCTGACTTTCATCAAGTTGTTGTTTCTATTGACTC
TCAGCAATCTACTTATGTCCAGGCCACTTCGACAACCTTATAATACTGATCAAGATCAAAATCCCACAGAGGATTATGTTCTTGTAATGGGTGAACTAAG
TCCATCTCCGATTCCAGTCCCAGTTTCCGTTCTAACAAGGCTGATCAAGAAGAAGCTTCCAGTGATGGCATTCAGCAGCTTGCTTGAAAGGTTAGTGAAG
CTTGAAGATGATCAAGAGAGCATGTGTCCTGTCTGCTTGGATTGTATTCAGGAAAGAGATGAAGTCAGAGAACTATGCAACTGTTCTCATGTGTTTCATA
TGAAGTGCCTGGATAGTTGGGTGGATCAAGGCCAGGTTACCTGCCCAACTTGCAGGTCCATGCTGTTTCCAAAGAAAATGGAAGCTGCTGAAATGTTTAT
ATTTGCTCATGATGATTCTGCCATGGTTGAGCAAGTTAGCTAA
AA sequence
>Potri.011G150800.1 pacid=42780789 polypeptide=Potri.011G150800.1.p locus=Potri.011G150800 ID=Potri.011G150800.1.v4.1 annot-version=v4.1
MGISFVAVKMPKCFGLQFLLEFLTFIKLLFLLTLSNLLMSRPLRQPYNTDQDQNPTEDYVLVMGELSPSPIPVPVSVLTRLIKKKLPVMAFSSLLERLVK
LEDDQESMCPVCLDCIQERDEVRELCNCSHVFHMKCLDSWVDQGQVTCPTCRSMLFPKKMEAAEMFIFAHDDSAMVEQVS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.011G150800 0 1
AT5G15080 Protein kinase superfamily pro... Potri.017G077300 14.28 0.7132
AT5G48820 ICK6, KRP3 KIP-RELATED PROTEIN 3, inhibit... Potri.001G314000 16.79 0.7106
AT5G16940 carbon-sulfur lyases (.1.2) Potri.017G132000 26.53 0.6600
AT3G43740 Leucine-rich repeat (LRR) fami... Potri.001G296500 28.54 0.6966 LRRP.3
AT1G75980 Single hybrid motif superfamil... Potri.002G018100 34.05 0.6680
AT3G43740 Leucine-rich repeat (LRR) fami... Potri.009G090700 34.79 0.6805
AT3G22400 ATLOX5, LOX5 Arabidopsis thaliana lipoxygen... Potri.010G089500 49.07 0.6242 LOX1.7
Potri.004G068901 49.59 0.6659
AT4G38040 Exostosin family protein (.1) Potri.010G197900 52.30 0.6304
AT1G07870 Protein kinase superfamily pro... Potri.009G026500 68.41 0.6269

Potri.011G150800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.