Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10500 287 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 285 / 1e-94 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 235 / 3e-75 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 189 / 4e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 181 / 3e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G60290 171 / 3e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 170 / 7e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G55290 165 / 7e-48 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 163 / 2e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT5G07480 162 / 3e-47 KUOX1 KAR-UP oxidoreductase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G451300 [exp] 436 / 5e-154 AT4G10500 326 / 1e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150300 [exp] 419 / 2e-147 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150200 [exp] 417 / 8e-147 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451500 [exp] 412 / 1e-144 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G164200 [exp] 388 / 4e-135 AT4G10500 305 / 4e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150400 [exp] 388 / 4e-135 AT4G10500 305 / 4e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451600 [exp] 373 / 2e-129 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451700 [exp] 362 / 5e-125 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 351 / 2e-120 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030185 [exp] 301 / 5e-101 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 250 / 5e-81 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 243 / 3e-78 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 209 / 3e-65 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 180 / 1e-53 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032502 [exp] 179 / 2e-53 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10014398 [exp] 180 / 3e-53 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 177 / 1e-52 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 169 / 7e-50 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021943 [exp] 167 / 2e-48 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.011G151000.1 pacid=42781402 polypeptide=Potri.011G151000.1.p locus=Potri.011G151000 ID=Potri.011G151000.1.v4.1 annot-version=v4.1 ATGTCTGCCATGGAGTCTCAACTTGCTGACGATGAACTAGCTGCATCTGGGGGGGCCGAGATATCAGATGGCTTCATCTCTCTCATTGACATGGAGGAAC TTCAAGGTCCTCGCCGCTCTGAGATTGTCCAACAAATTGGCCATGCATGCCAACACTATGGTTTCTTTCTGGTGAAGAACCATGGAATTTCAGAGACGAA TATGAACAATATATTGGGGACAACAAGCAAATTCTTCAAACTTCCAGAACAAGAAAAATTGAAGTTCTGCACTAATGACCCTAACAAAAGCATCAAGCTT TTTATGGGTTTTAAAGATGAGATCCAAAATGTCTTTGTCGCGAGGGAATCCTTAAGATTTAGCACTTACCCTTTTGAAGATTATGTGAATGAATGGCCTG CAAATCCTCCTTCATTGAGGAAGGATGTTATGGAGTATTGTACAAGTGTTAAAAGGGTGGAATTTGCACTTCTTGAGGCAATGTCTGAGAGCTTAGGATT GGAAAAAGATTATCTAGACAAGATGTTATACAACCATGGACAAAAAATATCAATGAACTATTACCCAATTTGTCAAGAACAAGATCTAGAGTTTACTCGT GGAGTGAGACATCATACAGACCCAACTATAATCACTATTCTGCTGCAAGACAATGTGCCTGGATTTAAGGTTCTCAACAATGGCAAATGGGTGGACGTTG GTCATATCCCAAACACTTTGGTTATTCATGTTGGAGACCTACTACAGGTAATTAGTAATTACCGTTACAAGAGTTTGCACCACCAAGTTTTTATTAATTG TGAGAGAGAGCGTGTATCTGTTGCAAGCTATTGCTATCCATCATCCGATACCACAATTGGGCCTGCTATGGAATTGATAGACAATGATCATCCAGCAATC TACAGAAATTTTACGTATACAGAATTTTATGAAGAAATGTGGCGAGCTGTAGTGCAGCATGCAACTGACAAGCGTTTGGACACCTTCAAGTCTTCTGTTG CCTGA
AA sequence Show only first row Show all	>Potri.011G151000.1 pacid=42781402 polypeptide=Potri.011G151000.1.p locus=Potri.011G151000 ID=Potri.011G151000.1.v4.1 annot-version=v4.1 MSAMESQLADDELAASGGAEISDGFISLIDMEELQGPRRSEIVQQIGHACQHYGFFLVKNHGISETNMNNILGTTSKFFKLPEQEKLKFCTNDPNKSIKL FMGFKDEIQNVFVARESLRFSTYPFEDYVNEWPANPPSLRKDVMEYCTSVKRVEFALLEAMSESLGLEKDYLDKMLYNHGQKISMNYYPICQEQDLEFTR GVRHHTDPTIITILLQDNVPGFKVLNNGKWVDVGHIPNTLVIHVGDLLQVISNYRYKSLHHQVFINCERERVSVASYCYPSSDTTIGPAMELIDNDHPAI YRNFTYTEFYEEMWRAVVQHATDKRLDTFKSSVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.011G151000 [exp]	0	1
AT4G21310			Protein of unknown function (D...		Potri.004G031200 [exp]	1.41	0.9543
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Potri.006G206400 [exp]	3.16	0.9292
AT5G53870		AtENODL1	early nodulin-like protein 1 (...		Potri.011G117800 [exp]	4.24	0.9036
					Potri.004G226200 [exp]	5.74	0.9140
AT2G41200			unknown protein		Potri.006G038600 [exp]	8.94	0.9289
					Potri.002G022100 [exp]	9.48	0.9170
AT5G53760		ATMLO11, MLO11	MILDEW RESISTANCE LOCUS O 11, ...		Potri.011G121600 [exp]	10.67	0.8868
					Potri.010G132000 [exp]	12.24	0.9070
					Potri.018G104500 [exp]	12.24	0.9208
					Potri.002G250900 [exp]	12.40	0.9080

Compare expression of checked genes

Potri.011G151000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.