Potri.011G154700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44560 332 / 9e-117 VPS2.2 SNF7 family protein (.1.2)
AT1G03950 281 / 6e-97 VPS2.3 vacuolar protein sorting-associated protein 2.3 (.1)
AT2G06530 148 / 2e-44 VPS2.1 SNF7 family protein (.1)
AT5G22950 66 / 5e-13 VPS24.1 SNF7 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G442500 367 / 7e-131 AT5G44560 328 / 3e-115 SNF7 family protein (.1.2)
Potri.005G227000 290 / 1e-100 AT1G03950 309 / 3e-108 vacuolar protein sorting-associated protein 2.3 (.1)
Potri.002G035900 287 / 2e-99 AT1G03950 308 / 8e-108 vacuolar protein sorting-associated protein 2.3 (.1)
Potri.018G065100 141 / 1e-41 AT2G06530 332 / 9e-117 SNF7 family protein (.1)
Potri.001G170400 141 / 1e-41 AT2G06530 326 / 2e-114 SNF7 family protein (.1)
Potri.008G034700 65 / 9e-13 AT5G22950 337 / 2e-118 SNF7 family protein (.1)
Potri.004G215500 62 / 2e-11 AT5G22950 332 / 6e-117 SNF7 family protein (.1)
Potri.006G144300 44 / 4e-06 AT2G06530 62 / 7e-13 SNF7 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038407 317 / 1e-110 AT5G44560 323 / 5e-113 SNF7 family protein (.1.2)
Lus10023396 241 / 4e-80 AT5G44560 270 / 2e-91 SNF7 family protein (.1.2)
Lus10033914 234 / 3e-78 AT1G03950 278 / 5e-96 vacuolar protein sorting-associated protein 2.3 (.1)
Lus10037660 145 / 2e-43 AT2G06530 358 / 6e-127 SNF7 family protein (.1)
Lus10017166 140 / 3e-41 AT2G06530 357 / 2e-126 SNF7 family protein (.1)
Lus10015642 132 / 9e-38 AT2G06530 338 / 1e-118 SNF7 family protein (.1)
Lus10003538 87 / 4e-22 AT1G03950 121 / 3e-36 vacuolar protein sorting-associated protein 2.3 (.1)
Lus10021561 71 / 2e-15 AT2G06530 194 / 1e-63 SNF7 family protein (.1)
Lus10021423 68 / 1e-13 AT5G22950 354 / 2e-125 SNF7 family protein (.1)
Lus10016143 66 / 7e-13 AT5G22950 357 / 2e-126 SNF7 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0235 PspA PF03357 Snf7 Snf7
Representative CDS sequence
>Potri.011G154700.1 pacid=42781852 polypeptide=Potri.011G154700.1.p locus=Potri.011G154700 ID=Potri.011G154700.1.v4.1 annot-version=v4.1
ATGAACATCTTCAAGAAGAAAACTTCTCCTAAAGAGGCTCTCAGGACTAGCAAGAGAGATATGGTGGTTGCTACTAGAGGTATTGAACGTGAAATTGCAT
CACTTCAACTGGAGGAGAAGAAATTGGTGGCAGAGATAAAGCAAACAGCAAAAACTGGAAATGAGGCTGCTACTAAAATCTTAGCCCGGCAACTTGTTCG
ACTTCGGCAACAAATAACAAATTTGCAGGGGAGTCGTGCCCAAATCAGAGGTGTTGCTACTCATACACAGGCGCTGTATGCCAGCACTTCAATCTCCACT
GGAATGAAAGGTGCAACTAAGGCAATGGTGGCTATGAACAAGCAAATGGCTCCTGCAAAACAAGCTAAAGTGATCAAAGAGTTCCAGAAGCAGTCAGCAC
AAATGGATATGACGATTGAGATGATGTCAGAAGCTATAGATGAGACTTTAGACAAAGATGAGGCTGAAGAGGAAACAGAGGAGCTCACTAACCAGGTGCT
TGATGAGATTGGTGTGGACATTGCATCTCAGTTATCTTCAGCTCCAAAAGGTCGGATCGCATCAAAGAATGCTCCTCCTAATGCTGTTACAAGTCCTGAA
TCTACCAATGTTGAGGATCTTGAGAAAAGACTGGCCTCTCTACGACGCATTTGA
AA sequence
>Potri.011G154700.1 pacid=42781852 polypeptide=Potri.011G154700.1.p locus=Potri.011G154700 ID=Potri.011G154700.1.v4.1 annot-version=v4.1
MNIFKKKTSPKEALRTSKRDMVVATRGIEREIASLQLEEKKLVAEIKQTAKTGNEAATKILARQLVRLRQQITNLQGSRAQIRGVATHTQALYASTSIST
GMKGATKAMVAMNKQMAPAKQAKVIKEFQKQSAQMDMTIEMMSEAIDETLDKDEAEEETEELTNQVLDEIGVDIASQLSSAPKGRIASKNAPPNAVTSPE
STNVEDLEKRLASLRRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G44560 VPS2.2 SNF7 family protein (.1.2) Potri.011G154700 0 1
AT2G34190 Xanthine/uracil permease famil... Potri.011G068200 1.00 0.9304
AT1G70280 NHL domain-containing protein ... Potri.010G094200 2.44 0.9176
AT5G32450 RNA binding (RRM/RBD/RNP motif... Potri.019G037600 3.00 0.9172
AT2G01210 Leucine-rich repeat protein ki... Potri.010G120100 4.58 0.8859
AT1G01225 NC domain-containing protein-r... Potri.014G101300 6.32 0.9058
Potri.015G107125 7.93 0.8662
AT3G66658 ALDH22A1 aldehyde dehydrogenase 22A1 (.... Potri.008G106000 8.06 0.9079 ALDH22.1
AT5G13000 CALS3, ATGSL12 callose synthase 3, glucan syn... Potri.001G012200 8.36 0.9052 Pt-CALS1.3
AT3G57880 Calcium-dependent lipid-bindin... Potri.016G049100 8.48 0.9005
AT5G52840 NADH-ubiquinone oxidoreductase... Potri.017G149100 8.94 0.8900

Potri.011G154700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.