Potri.011G155350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G440400 63 / 4e-14 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G155350.1 pacid=42781894 polypeptide=Potri.011G155350.1.p locus=Potri.011G155350 ID=Potri.011G155350.1.v4.1 annot-version=v4.1
ATGGCTACCAAAACTTCCTCGAAAGTGGTCTTGAAACCTATATTCTTGTTAGGCTTGTTTCTGTTGATCACTTGTCTTGCACTACAGATTGATGCTCGCC
AACTCAAGGAAGAAAATGGAAAGCCTATGAAGTTTGATAAAATCAATGCCAAGAAGGGATTGGGAGAGATGAAGAACTTGCCACCATTTCCAAACATACC
AATTCCTGGAATCCCATTTCCTCAATTTCCATTTCCACCTCCATTTGACATTCCTAATGTCCCTCCACTTCCTGACTTTCCTTTCCCACCTATCCCTTTC
CCTCCGTCTCCTCCAGCATGA
AA sequence
>Potri.011G155350.1 pacid=42781894 polypeptide=Potri.011G155350.1.p locus=Potri.011G155350 ID=Potri.011G155350.1.v4.1 annot-version=v4.1
MATKTSSKVVLKPIFLLGLFLLITCLALQIDARQLKEENGKPMKFDKINAKKGLGEMKNLPPFPNIPIPGIPFPQFPFPPPFDIPNVPPLPDFPFPPIPF
PPSPPA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.011G155350 0 1
AT3G07880 SCN1 SUPERCENTIPEDE1, Immunoglobuli... Potri.016G013700 14.83 0.8140 GDI1.2
AT4G24780 Pectin lyase-like superfamily ... Potri.012G091500 20.09 0.8135
AT5G39420 CDC2CAT CDC2C (.1) Potri.017G088200 36.86 0.8052
AT1G28110 SCPL45 serine carboxypeptidase-like 4... Potri.001G065900 36.98 0.7849
AT1G03820 unknown protein Potri.017G015700 43.31 0.7765
AT1G15670 Galactose oxidase/kelch repeat... Potri.001G178500 70.69 0.7684
AT2G30690 Protein of unknown function, D... Potri.002G042500 70.71 0.7690
AT3G03000 EF hand calcium-binding protei... Potri.003G095700 93.06 0.7533
AT2G47930 AGP26, ATAGP26 ARABIDOPSIS THALIANA ARABINOGA... Potri.002G207500 111.81 0.7647
AT4G02110 transcription coactivators (.1... Potri.002G197400 115.41 0.7215

Potri.011G155350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.