Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44680 96 / 3e-25 HDA09, HDA9 histone deacetylase 9 (.1) AT4G38130 50 / 4e-09 ATHDA19, ATHD1, RPD3A, HDA19, HD1 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) AT5G35600 50 / 6e-09 HDA7 histone deacetylase7 (.1) AT5G63110 49 / 1e-08 RPD3B, CAT1, AXE1, ATHDA6, SIL1, RTS1, HDA6 RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1, histone deacetylase 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G460000 [exp] 117 / 2e-33 AT3G44680 739 / 0.0 histone deacetylase 9 (.1) Potri.012G083800 [exp] 58 / 1e-11 AT5G63110 716 / 0.0 RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1, histone deacetylase 6 (.1) Potri.015G082500 [exp] 57 / 3e-11 AT5G63110 728 / 0.0 RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1, histone deacetylase 6 (.1) Potri.004G209800 [exp] 50 / 8e-09 AT4G38130 815 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) Potri.009G170700 [exp] 50 / 9e-09 AT4G38130 811 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020570 [exp] 106 / 3e-29 AT3G44680 806 / 0.0 histone deacetylase 9 (.1) Lus10006274 [exp] 106 / 5e-29 AT3G44680 756 / 0.0 histone deacetylase 9 (.1) Lus10019486 [exp] 55 / 1e-10 AT5G63110 727 / 0.0 RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1, histone deacetylase 6 (.1) Lus10001356 [exp] 51 / 4e-09 AT4G38130 809 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) Lus10001605 [exp] 50 / 1e-08 AT4G38130 833 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2) Lus10043337 [exp] 39 / 5e-05 AT5G63110 629 / 0.0 RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1, histone deacetylase 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G156250.1 pacid=42781109 polypeptide=Potri.011G156250.1.p locus=Potri.011G156250 ID=Potri.011G156250.1.v4.1 annot-version=v4.1 ATGACACACCATCTTGTTCTCTCTTACGAGCTTCACAAGAAGATGGAAGTTTTTAGACCCCACAAGGCATATCCGGTTGAGCTTGCTCAGTTTCATTCAG AGGATTATGTTGAATTTTTGCATCGGATTACGCCAGATACTCAGCACTTGTTTGCGGGGGAAATGGCTAGATGTGTGGATTTTTCGTTGTGA
AA sequence Show only first row Show all	>Potri.011G156250.1 pacid=42781109 polypeptide=Potri.011G156250.1.p locus=Potri.011G156250 ID=Potri.011G156250.1.v4.1 annot-version=v4.1 MTHHLVLSYELHKKMEVFRPHKAYPVELAQFHSEDYVEFLHRITPDTQHLFAGEMARCVDFSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G44680		HDA09, HDA9	histone deacetylase 9 (.1)		Potri.011G156250 [exp]	0	1
AT5G59970			Histone superfamily protein (....		Potri.002G143850 [exp]	3.16	0.6319
AT5G40420		OLE2, PA23, OLE...	oleosin 2 (.1)		Potri.015G081901 [exp]	14.69	0.5978
					Potri.010G084600 [exp]	36.66	0.5638
AT3G25780		AOC3, AOC2	allene oxide cyclase 3 (.1)		Potri.017G112400 [exp]	58.77	0.5490
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Potri.008G125300 [exp]	59.69	0.5409	CYP96.3
					Potri.013G154650 [exp]	60.66	0.4834
AT5G10050			NAD(P)-binding Rossmann-fold s...		Potri.007G007300 [exp]	68.02	0.5438
AT5G15110			Pectate lyase family protein (...		Potri.008G148800 [exp]	94.74	0.5340
					Potri.010G154250 [exp]	130.58	0.4805
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Potri.015G077700 [exp]	154.11	0.4667

Compare expression of checked genes

Potri.011G156250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.