Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23460 291 / 9e-98 Pectin lyase-like superfamily protein (.1) AT1G70500 277 / 4e-92 Pectin lyase-like superfamily protein (.1) AT1G80170 181 / 6e-55 Pectin lyase-like superfamily protein (.1) AT3G07970 150 / 2e-43 QRT2 QUARTET 2, Pectin lyase-like superfamily protein (.1) AT3G57510 149 / 6e-43 ADPG1 Pectin lyase-like superfamily protein (.1) AT5G14650 149 / 8e-43 Pectin lyase-like superfamily protein (.1) AT1G48100 149 / 9e-43 Pectin lyase-like superfamily protein (.1) AT4G01890 149 / 1e-42 Pectin lyase-like superfamily protein (.1) AT2G41850 148 / 1e-42 ADPG2, PGAZAT ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 2, polygalacturonase abscission zone A. thaliana (.1) AT1G02460 144 / 1e-40 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G159000 [exp] 427 / 6e-151 AT1G23460 667 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.001G463000 [exp] 348 / 5e-120 AT1G23460 634 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.008G211900 [exp] 315 / 7e-107 AT1G23460 638 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.001G171900 [exp] 173 / 5e-52 AT1G80170 506 / 1e-178 Pectin lyase-like superfamily protein (.1) Potri.009G060400 [exp] 165 / 7e-49 AT3G07970 514 / 0.0 QUARTET 2, Pectin lyase-like superfamily protein (.1) Potri.016G054800 [exp] 165 / 7e-49 AT2G41850 421 / 7e-145 ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE 2, polygalacturonase abscission zone A. thaliana (.1) Potri.002G190600 [exp] 163 / 6e-48 AT1G02460 582 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.006G052700 [exp] 162 / 1e-47 AT3G07970 449 / 7e-156 QUARTET 2, Pectin lyase-like superfamily protein (.1) Potri.014G115700 [exp] 161 / 1e-46 AT1G02460 593 / 0.0 Pectin lyase-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030888 [exp] 303 / 6e-103 AT1G70500 461 / 3e-161 Pectin lyase-like superfamily protein (.1) Lus10029139 [exp] 301 / 4e-102 AT1G23460 574 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10030602 [exp] 303 / 1e-101 AT1G23460 624 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10036084 [exp] 170 / 9e-51 AT1G80170 491 / 2e-172 Pectin lyase-like superfamily protein (.1) Lus10026299 [exp] 157 / 1e-46 AT3G07970 418 / 3e-145 QUARTET 2, Pectin lyase-like superfamily protein (.1) Lus10019711 [exp] 157 / 5e-46 AT3G07970 461 / 1e-160 QUARTET 2, Pectin lyase-like superfamily protein (.1) Lus10042371 [exp] 156 / 3e-45 AT3G07970 432 / 5e-149 QUARTET 2, Pectin lyase-like superfamily protein (.1) Lus10029511 [exp] 155 / 4e-45 AT3G07970 480 / 1e-167 QUARTET 2, Pectin lyase-like superfamily protein (.1) Lus10038059 [exp] 155 / 1e-44 AT1G02460 542 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10009994 [exp] 155 / 1e-44 AT1G02460 606 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [poplar] [flax] Pec_lyase-like PF00295 [poplar] [flax] Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence Show only first row Show all	>Potri.011G159801.1 pacid=42781675 polypeptide=Potri.011G159801.1.p locus=Potri.011G159801 ID=Potri.011G159801.1.v4.1 annot-version=v4.1 ATGAAGGGAATATATTGTGGACCGGGACATGGAGTCAGCATTGGAAGTCTAGGGAAGGACAACTCAACAGGCATAGTCACAAAGGTGGTCCTGGATACTG CACTTATCAGGGAGACAACGAATGGCGTCAGGATTAAGACTTGGCAGGGAGGTAATGGTTATGTTCGCGGGGTACGTTTTGAAAATGTCAGGATGGACAA TGTTGATAACCCCATCATCATTGACCAATTCTACTGTGATTCCCCGAAATCGTGCCAAAACCAGACATCAGCAGTGAGAATTAGCGAGATCATGTACCGC AATATTAGTGGCACTACAAAGAGTGCAAAAGCGATGAAGTTTTCCTGCAGTGACACAGCTCCTTGCAGCACCATAGTCCTGAGCAACGTAAACTTGGAGA AGGAGGATGGCACAGTAGAGACCTACTGCAATTCGGCCGAAGGCTTTGGATATGGCATTGTTCACCCATCAGCTGATTGCTTAACTTCCCATGACAAAGA CTATAGTTTCTTCGAGCAGACAGAAGTTTCCCAAGACTACATTCTCAACGACGTGACGGAAGAAAAGGTTGAGCTTGCAGATTCCAACAACGACCGCATT GTTCATACTGAACTTTGA
AA sequence Show only first row Show all	>Potri.011G159801.1 pacid=42781675 polypeptide=Potri.011G159801.1.p locus=Potri.011G159801 ID=Potri.011G159801.1.v4.1 annot-version=v4.1 MKGIYCGPGHGVSIGSLGKDNSTGIVTKVVLDTALIRETTNGVRIKTWQGGNGYVRGVRFENVRMDNVDNPIIIDQFYCDSPKSCQNQTSAVRISEIMYR NISGTTKSAKAMKFSCSDTAPCSTIVLSNVNLEKEDGTVETYCNSAEGFGYGIVHPSADCLTSHDKDYSFFEQTEVSQDYILNDVTEEKVELADSNNDRI VHTEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G23460			Pectin lyase-like superfamily ...		Potri.011G159801 [exp]	0	1
AT1G23460			Pectin lyase-like superfamily ...		Potri.011G159000 [exp]	1.00	0.9525
AT3G61490			Pectin lyase-like superfamily ...		Potri.003G131700 [exp]	1.41	0.9356
AT4G00230		XSP1	xylem serine peptidase 1 (.1)		Potri.002G151900 [exp]	1.73	0.9305
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Potri.016G138600 [exp]	3.46	0.9184
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Potri.014G000800 [exp]	3.74	0.8216
AT5G04200		AtMCP2f, ATMC9	metacaspase 2f, metacaspase 9 ...		Potri.016G024500 [exp]	3.87	0.9014
AT1G12260	NAC	ANAC007, VND4, ...	VASCULAR RELATED NAC-DOMAIN PR...		Potri.012G126500 [exp]	4.24	0.8910	NAC037
AT1G34575			FAD-binding Berberine family p...		Potri.011G158400 [exp]	5.29	0.8748
AT1G10800			unknown protein		Potri.014G147600 [exp]	6.32	0.8742
AT3G01860			unknown protein		Potri.008G176300 [exp]	7.34	0.8171

Compare expression of checked genes

Potri.011G159801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.