Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-GER2.29
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1) AT5G39130 266 / 6e-91 RmlC-like cupins superfamily protein (.1) AT5G39160 264 / 5e-90 RmlC-like cupins superfamily protein (.1.2.3) AT5G39190 263 / 9e-90 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39110 261 / 5e-89 RmlC-like cupins superfamily protein (.1) AT5G39120 258 / 1e-87 RmlC-like cupins superfamily protein (.1) AT5G39150 255 / 1e-86 RmlC-like cupins superfamily protein (.1) AT5G39180 254 / 2e-86 RmlC-like cupins superfamily protein (.1) AT5G38940 248 / 6e-84 RmlC-like cupins superfamily protein (.1) AT4G14630 245 / 1e-82 GLP9 germin-like protein 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G162932 [exp] 432 / 1e-156 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1) Potri.011G163800 [exp] 406 / 2e-146 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1) Potri.011G163216 [exp] 365 / 4e-130 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163300 [exp] 364 / 1e-129 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.001G465100 [exp] 360 / 4e-128 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G162200 [exp] 296 / 4e-103 AT5G39190 246 / 4e-83 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.001G464100 [exp] 293 / 1e-101 AT5G39190 231 / 3e-77 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.001G464000 [exp] 290 / 1e-100 AT5G39190 231 / 4e-77 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.013G052100 [exp] 285 / 2e-98 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035185 [exp] 331 / 1e-116 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10035186 [exp] 328 / 2e-115 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Lus10032016 [exp] 325 / 2e-114 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10032015 [exp] 323 / 1e-113 AT5G39160 262 / 3e-89 RmlC-like cupins superfamily protein (.1.2.3) Lus10035278 [exp] 321 / 2e-112 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10030048 [exp] 318 / 3e-111 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 317 / 7e-111 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10032017 [exp] 318 / 3e-110 AT3G05950 252 / 5e-84 RmlC-like cupins superfamily protein (.1) Lus10034254 [exp] 313 / 1e-109 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10035279 [exp] 312 / 4e-109 AT5G39160 244 / 2e-82 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.011G163200.1 pacid=42780350 polypeptide=Potri.011G163200.1.p locus=Potri.011G163200 ID=Potri.011G163200.1.v4.1 annot-version=v4.1 ATGGCTTCTTCCATTCTTTTCTTTGGATTCCTAGCTCTGTCCTTCATCCATGCCCTAGCATCGGATCCAGGCTCACTTCAAGATTTCTGCGTGGCAGATG AAACCAGTAATGTGATAGTGAATGGTTTGGCTTGCAAGGATCCCGAAATGGTTCAAGCTGATGACTTCTCCTTCAGTGGACTTCACTTGGCAGGCAACAC TTCAAACGCTGTAGGGTCTAGGGTAACCACAGTAAACGTAGCCCAGATACCAGGGCTTAACACACTTGGAATCTCTCTTGTTCGCATCGACTACGCACCA TGGGGCATTAACCCTCCACACACACACCCTCGTGGAACTGAAATCTTGACTGTCATTGAAGGTAGTCTTGAGGTTGGGTTCGTGACATCCAACCCTGAAA ACCGTCTCATCACAAAAGTTCTACAAAAGGGTGATGTGTTTGTATTTCCTATTGGTCTCGTTCACTTTCAGAGAAGTGTTGGAAATGGCAACGCCGTAGC CATTGCAGCTCTGAGCAGCCAAAATCCAGGTGTCATTACCATTGCAAATGCTGTGTTTGGCTCCACCCCAGAGATCCCAAGTGACATTCTAGTGAAGGCT TTCCAGTTGGATAAGAATGTTGTCAATTACCTTCAATCCAAGTTCTAA
AA sequence Show only first row Show all	>Potri.011G163200.1 pacid=42780350 polypeptide=Potri.011G163200.1.p locus=Potri.011G163200 ID=Potri.011G163200.1.v4.1 annot-version=v4.1 MASSILFFGFLALSFIHALASDPGSLQDFCVADETSNVIVNGLACKDPEMVQADDFSFSGLHLAGNTSNAVGSRVTTVNVAQIPGLNTLGISLVRIDYAP WGINPPHTHPRGTEILTVIEGSLEVGFVTSNPENRLITKVLQKGDVFVFPIGLVHFQRSVGNGNAVAIAALSSQNPGVITIANAVFGSTPEIPSDILVKA FQLDKNVVNYLQSKF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05950			RmlC-like cupins superfamily p...		Potri.011G163200 [exp]	0	1	Pt-GER2.29
AT3G05950			RmlC-like cupins superfamily p...		Potri.011G162932 [exp]	1.00	0.9758
AT5G39130			RmlC-like cupins superfamily p...		Potri.011G163800 [exp]	2.44	0.8671	GER2.27
AT1G64160			Disease resistance-responsive ...		Potri.001G096680 [exp]	5.47	0.8463
AT1G64160			Disease resistance-responsive ...		Potri.013G142501 [exp]	7.00	0.8434
AT1G13410			Tetratricopeptide repeat (TPR)...		Potri.010G123901 [exp]	7.07	0.8001
AT1G64160			Disease resistance-responsive ...		Potri.001G096800 [exp]	7.34	0.8351	Pt-DRR206.2
AT1G64160			Disease resistance-responsive ...		Potri.013G142602 [exp]	7.48	0.8419
AT1G04220		KCS2	3-ketoacyl-CoA synthase 2 (.1)		Potri.005G217000 [exp]	10.72	0.8145
AT1G04360			RING/U-box superfamily protein...		Potri.008G165900 [exp]	14.69	0.8117
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.009G078400 [exp]	17.66	0.8050	UF3.3

Compare expression of checked genes

Potri.011G163200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.