Potri.011G164150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G121900 69 / 1e-14 AT3G14470 399 / 2e-122 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.011G164150.1 pacid=42782402 polypeptide=Potri.011G164150.1.p locus=Potri.011G164150 ID=Potri.011G164150.1.v4.1 annot-version=v4.1
ATGATTTATCAAGCCTTACATCAAGGCTTACAACACCCCCTCAAACGGATATTCCCAAGTGCGACAGTCATTGAGTATTTTAATGTGATCACGAGCTCAC
CACTCTTCCAAGAGTCTACTCATCCCGGAGTTGCGTCTGCCCTCTGTTCCTCCCTAGGAACCACGCCTTACTTCTCCGTGAGTCTCCCGCTCTTAGTCTC
AAGAGTCCAGGTGGCTCTCCCTTTTAACCATGGGGACAGCCCATTAAAGGTTGATCCATCTCTATCTTCATACTCTGAGTATTACAATGTCATTACTGAG
CTCACCACCTTGACAAGAGTCAACTTGTTCCTGGAACCTGCGCATGCCCTCTGCTCCTTCATAGCAGTCGCGTCTTAA
AA sequence
>Potri.011G164150.1 pacid=42782402 polypeptide=Potri.011G164150.1.p locus=Potri.011G164150 ID=Potri.011G164150.1.v4.1 annot-version=v4.1
MIYQALHQGLQHPLKRIFPSATVIEYFNVITSSPLFQESTHPGVASALCSSLGTTPYFSVSLPLLVSRVQVALPFNHGDSPLKVDPSLSSYSEYYNVITE
LTTLTRVNLFLEPAHALCSFIAVAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.011G164150 0 1
Potri.001G248704 3.16 0.7127
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Potri.001G342200 4.47 0.6606
AT1G53820 RING/U-box superfamily protein... Potri.003G073300 8.06 0.6715
AT3G63380 ATPase E1-E2 type family prote... Potri.013G038400 16.70 0.6608
AT5G66760 SDH1-1 succinate dehydrogenase 1-1 (.... Potri.007G026400 18.97 0.6925 Pt-SDH1.1
Potri.009G094450 27.64 0.5689
Potri.007G106600 34.64 0.5588
AT5G13420 Aldolase-type TIM barrel famil... Potri.001G068200 42.60 0.6545
AT2G16460 Protein of unknown function (D... Potri.009G123700 80.42 0.6265
AT5G09960 unknown protein Potri.005G084700 85.44 0.5765

Potri.011G164150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.