Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10500 304 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 303 / 2e-101 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 258 / 6e-84 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 192 / 4e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 184 / 7e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G60290 181 / 9e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 177 / 2e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G08640 176 / 2e-52 ATFLS1, FLS flavonol synthase 1 (.1.2) AT1G78550 174 / 4e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G07480 172 / 1e-50 KUOX1 KAR-UP oxidoreductase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G150400 [exp] 735 / 0 AT4G10500 305 / 4e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451300 [exp] 429 / 5e-151 AT4G10500 326 / 1e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150300 [exp] 424 / 4e-149 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451500 [exp] 424 / 6e-149 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150200 [exp] 417 / 4e-146 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G151000 [exp] 387 / 6e-135 AT4G10500 287 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451600 [exp] 348 / 3e-119 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 347 / 1e-118 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 338 / 2e-115 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030185 [exp] 293 / 1e-97 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 257 / 1e-83 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 253 / 8e-82 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 221 / 3e-69 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 202 / 9e-62 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 193 / 9e-59 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 188 / 5e-57 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 188 / 2e-56 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032502 [exp] 181 / 1e-53 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10005037 [exp] 177 / 4e-52 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.011G164200.1 pacid=42782041 polypeptide=Potri.011G164200.1.p locus=Potri.011G164200 ID=Potri.011G164200.1.v4.1 annot-version=v4.1 ATGGCTCCCACAAAGGCAGTAGTAGCCGATGATCACCTTGCATTACCCGCAGGGGGCAAAAATACTCCACTAACCAACACCATTCCCATTTCCAATGTTC AAACCGATATCTATGGGCTTGAGATCTGGGAGGGTACCCTCCCCATCATCGACCTGGGAGGCATTCATGGTCCTCGCCGCTCTGACACCATCAAACAGCT TGGCCATGCATGCCAACACTATGGTGGCTTTATGCTGAAGAACCATGGCATTTCAGAGAGATTGTTGAATGACATAATGAGCAAAGCAAGAGAGTTCTTC CATCTGCCAGAAGAAGAAAGGATGAAATTATACTCTCCTGACCCTACCAGCCTTATCAGGCTTGCTACTGGCTTTAAGGACGATAATCAGAATGTCTTCG TCTCGAGGGAATCGTTGAAATTTCATTGTCATCCTATTGAAAATTATGAGAATCTATGGCCTACAAATCCTCCATCCTACAGGGAGGTTGTATCCGAGTA TTGTGTAGCTGCTAAAAGGGCAGAGATAACACTACTTGAAGCTGTATTCGAGGGCTTAGGCATGGAAAGGAAATCTATAGACCAGATATTGGACAACCAT GGACAATACGCTTCTCTAAACTACTATCCGACGTGTGACAAGTCAAATCTTGGGCTCACTTTTGGACTGCGTGGTCACACTGACCCCACTATACTCACCA TGCTACTGCCAGATGAGGTGCCTGGGCTTGAAATTCTACAAGATGGTGACTGGGTACCTGTCAAGCCTATTCCTAACACCTTAATTGTCCATGTTGGTGA CGTGCTTCAGGGGCTTAGCAATTGCCGATACAAGAGTTTGCTCCATCGAGTTATTGTCAATTCTGAGAAAGAACGTTTATCCATTGCTTCATATTGCTAT CCATCAAATGATACTCAAATGGGGCCTCCTAAGGAATTGATCGATGATGATCATCCATTGATTTATAAAGATTACACCTACGAAGAATTCTACACTACAA TGTGGAAACAAAGACTTCCAGATGCCTCCCGCTTGGACTCATTCAAAGTTTCTGCTGCTTAA
AA sequence Show only first row Show all	>Potri.011G164200.1 pacid=42782041 polypeptide=Potri.011G164200.1.p locus=Potri.011G164200 ID=Potri.011G164200.1.v4.1 annot-version=v4.1 MAPTKAVVADDHLALPAGGKNTPLTNTIPISNVQTDIYGLEIWEGTLPIIDLGGIHGPRRSDTIKQLGHACQHYGGFMLKNHGISERLLNDIMSKAREFF HLPEEERMKLYSPDPTSLIRLATGFKDDNQNVFVSRESLKFHCHPIENYENLWPTNPPSYREVVSEYCVAAKRAEITLLEAVFEGLGMERKSIDQILDNH GQYASLNYYPTCDKSNLGLTFGLRGHTDPTILTMLLPDEVPGLEILQDGDWVPVKPIPNTLIVHVGDVLQGLSNCRYKSLLHRVIVNSEKERLSIASYCY PSNDTQMGPPKELIDDDHPLIYKDYTYEEFYTTMWKQRLPDASRLDSFKVSAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.011G164200 [exp]	0	1
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.011G150400 [exp]	1.00	0.9680
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.005G143900 [exp]	3.16	0.8977	IFS1.45,CYP81S8
AT1G30700			FAD-binding Berberine family p...		Potri.001G462466 [exp]	19.10	0.8161
AT4G20820			FAD-binding Berberine family p...		Potri.011G162968 [exp]	24.37	0.8673
					Potri.011G167566 [exp]	24.67	0.8460
AT5G61820			unknown protein		Potri.015G108800 [exp]	25.21	0.8702
AT1G17860			Kunitz family trypsin and prot...		Potri.017G153600 [exp]	26.07	0.8602
AT5G02070			Protein kinase family protein ...		Potri.008G059900 [exp]	27.45	0.8592
AT5G05340			Peroxidase superfamily protein...		Potri.013G154400 [exp]	31.74	0.8396	Pt-PRX1.9
AT4G20820			FAD-binding Berberine family p...		Potri.011G162900 [exp]	33.48	0.8498

Compare expression of checked genes

Potri.011G164200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.