Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62065 35 / 0.0007 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G139700 [exp] 42 / 2e-06 AT5G62065 101 / 6e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.011G021900 [exp] 38 / 6e-05 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.016G135700 [exp] 37 / 9e-05 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.001G232900 [exp] 36 / 0.0004 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039270 [exp] 44 / 6e-07 AT5G59310 69 / 4e-16 lipid transfer protein 4 (.1) Lus10042512 [exp] 42 / 2e-06 AT2G18370 64 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10031282 [exp] 42 / 2e-06 AT4G33355 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10031851 [exp] 42 / 6e-06 AT5G58510 109 / 2e-27 unknown protein Lus10012392 [exp] 40 / 1e-05 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032716 [exp] 38 / 2e-05 AT4G33355 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10028003 [exp] 39 / 3e-05 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028002 [exp] 39 / 3e-05 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10012384 [exp] 39 / 3e-05 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1) Lus10009003 [exp] 39 / 4e-05 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G165750.1 pacid=42781418 polypeptide=Potri.011G165750.1.p locus=Potri.011G165750 ID=Potri.011G165750.1.v4.1 annot-version=v4.1 ATGCCTGTTGTGCGCGCAGCTGCACAGAAACTGGACAGGCTAGCTTCTACATCTCCTGTTGAGCGCAAGAATCTTTGCAAATGTTTTGTGGGAGCTATAA AGAGATTCCCTGTTAACCTTGAGAAAGTTCAGCGACTTCCCAAGCTTTGCAAACTCCATGTCACCCTTCTTAGCAACCCTAATGTCGATTGCAGCAAGTT TTGA
AA sequence Show only first row Show all	>Potri.011G165750.1 pacid=42781418 polypeptide=Potri.011G165750.1.p locus=Potri.011G165750 ID=Potri.011G165750.1.v4.1 annot-version=v4.1 MPVVRAAAQKLDRLASTSPVERKNLCKCFVGAIKRFPVNLEKVQRLPKLCKLHVTLLSNPNVDCSKF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.011G165750 [exp]	0	1
AT5G55590		QRT1	QUARTET 1, Pectin lyase-like s...		Potri.001G365700 [exp]	13.49	0.8962
					Potri.001G165120 [exp]	15.96	0.8257
					Potri.002G131650 [exp]	18.97	0.8370
AT1G43760			DNAse I-like superfamily prote...		Potri.015G069301 [exp]	19.36	0.7508
AT1G43760			DNAse I-like superfamily prote...		Potri.005G151350 [exp]	22.84	0.7334
					Potri.014G039333 [exp]	23.66	0.7939
AT3G28480			Oxoglutarate/iron-dependent ox...		Potri.017G075300 [exp]	23.68	0.7190
AT5G28780			PIF1 helicase (.1)		Potri.001G165240 [exp]	24.97	0.7567
AT4G35700	C2H2ZnF	DAZ3	DUO1-activated zinc finger 3, ...		Potri.005G100300 [exp]	29.08	0.6447
AT5G34883			Protein of unknown function (D...		Potri.018G045400 [exp]	30.39	0.6479

Compare expression of checked genes

Potri.011G165750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.