Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1) AT2G17880 88 / 2e-22 Chaperone DnaJ-domain superfamily protein (.1) AT4G36040 85 / 4e-21 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) AT4G13830 61 / 7e-12 J20 DNAJ-like 20 (.1.2) AT2G22360 62 / 2e-11 DNAJ heat shock family protein (.1) AT4G39960 60 / 7e-11 Molecular chaperone Hsp40/DnaJ family protein (.1) AT3G47940 56 / 2e-09 DNAJ heat shock family protein (.1) AT2G35720 55 / 3e-09 OWL1 ORIENTATION UNDER VERY LOW FLUENCES OF LIGHT 1, DNAJ heat shock N-terminal domain-containing protein (.1) AT3G62600 54 / 8e-09 ATERDJ3B DNAJ heat shock family protein (.1) AT1G77930 54 / 8e-09 Chaperone DnaJ-domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G469600 [exp] 209 / 4e-70 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G107600 [exp] 127 / 8e-38 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.006G001301 [exp] 112 / 5e-32 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G113100 [exp] 90 / 2e-23 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G172300 [exp] 90 / 5e-23 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020800 [exp] 86 / 2e-21 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020700 [exp] 84 / 8e-21 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G240700 [exp] 83 / 2e-20 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G131800 [exp] 81 / 2e-20 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032957 [exp] 100 / 4e-27 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1) Lus10017263 [exp] 87 / 1e-21 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10034484 [exp] 83 / 7e-21 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10041906 [exp] 81 / 1e-19 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10028453 [exp] 79 / 7e-19 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Lus10013558 [exp] 66 / 2e-14 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10025060 [exp] 66 / 2e-14 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10002355 [exp] 62 / 5e-12 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2) Lus10003150 [exp] 61 / 1e-11 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2) Lus10002356 [exp] 60 / 3e-11 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF00226 [poplar] [flax] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Potri.011G166500.1 pacid=42780451 polypeptide=Potri.011G166500.1.p locus=Potri.011G166500 ID=Potri.011G166500.1.v4.1 annot-version=v4.1 ATGTACACTACGTTCGCTCCCTCCCCTCTAACCGCTGTGACCTCCGTAATCACCGCCGCGGCAACCTCGAACACAGTTCAAAAGCCTATCCTTTTATCAC CGGTTAAAACAACCGCCGGTCGTTCTTGTCGGGGTTTACAAATCAAAGCCTCGGTCTCAACGTTTCCTGACTCGACCCGAGTCGACTCAAGGTATTCAAC GCTGAGTCTGTACGATGTACTCCGGGTGAATCCAGCTGCGTCGCAAGTGGAGATCAAGTCAGCGTACAGGAGTCTTGCGAAGATTTACCATCCTGATGCT TTTTTGAGTCATGATCGTGATCATGATGACGAGCAATCGGACGGTGGAGATTTTATCGAGATTCATAGTGCTTATGAGACGTTATCCGATCCGACTGCTA GAGCGGTTTATGACCTGTCTTTATCGGCAGCGGCGAGGTGTTTTTACAGGAGAGCGGCCGGGTATTCGGGCGGGGATTATACGACCCGAAGATGGGAAAC AGATCAGTGCTGGTAA
AA sequence Show only first row Show all	>Potri.011G166500.1 pacid=42780451 polypeptide=Potri.011G166500.1.p locus=Potri.011G166500 ID=Potri.011G166500.1.v4.1 annot-version=v4.1 MYTTFAPSPLTAVTSVITAAATSNTVQKPILLSPVKTTAGRSCRGLQIKASVSTFPDSTRVDSRYSTLSLYDVLRVNPAASQVEIKSAYRSLAKIYHPDA FLSHDRDHDDEQSDGGDFIEIHSAYETLSDPTARAVYDLSLSAAARCFYRRAAGYSGGDYTTRRWETDQCW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13310			Chaperone DnaJ-domain superfam...		Potri.011G166500 [exp]	0	1
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.008G095300 [exp]	3.00	0.8147
AT5G58950			Protein kinase superfamily pro...		Potri.007G085300 [exp]	4.47	0.8311
					Potri.005G059900 [exp]	13.19	0.8322
AT1G50370		AtFYPP1	flower- specific, phytochrome-...		Potri.010G254500 [exp]	18.73	0.7853	ATFYPP3.1
AT5G38710			Methylenetetrahydrofolate redu...		Potri.004G106400 [exp]	20.00	0.8273
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Potri.015G134600 [exp]	20.92	0.8199	Pt-GA20.2,GA20ox8
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Potri.019G052200 [exp]	26.72	0.8073
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Potri.008G054700 [exp]	28.49	0.7713	Pt-HSP70.6
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Potri.008G191600 [exp]	29.49	0.7193
AT1G35520	ARF	ARF15	auxin response factor 15 (.1)		Potri.012G012950 [exp]	35.46	0.8059

Compare expression of checked genes

Potri.011G166500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.