Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34790 49 / 2e-08 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST 23, EMBRYO SAC DEVELOPMENT ARREST 28, FAD-binding Berberine family protein (.1) AT1G30700 49 / 3e-08 FAD-binding Berberine family protein (.1) AT5G44380 45 / 6e-07 FAD-binding Berberine family protein (.1) AT1G30710 45 / 6e-07 FAD-binding Berberine family protein (.1) AT1G30760 44 / 1e-06 FAD-binding Berberine family protein (.1) AT5G44400 44 / 1e-06 FAD-binding Berberine family protein (.1) AT5G44360 44 / 2e-06 FAD-binding Berberine family protein (.1) AT1G30720 43 / 3e-06 FAD-binding Berberine family protein (.1) AT1G34575 43 / 4e-06 FAD-binding Berberine family protein (.1) AT5G44410 42 / 5e-06 FAD-binding Berberine family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G464700 [exp] 72 / 1e-16 AT5G44440 484 / 4e-167 FAD-binding Berberine family protein (.1) Potri.001G440700 [exp] 61 / 2e-12 AT4G20820 552 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G162666 [exp] 59 / 4e-12 AT5G44440 506 / 6e-176 FAD-binding Berberine family protein (.1) Potri.001G464800 [exp] 59 / 7e-12 AT4G20820 526 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G162884 [exp] 58 / 1e-11 AT4G20820 527 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G162828 [exp] 58 / 1e-11 AT5G44440 521 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G162900 [exp] 58 / 1e-11 AT4G20820 526 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G162968 [exp] 56 / 6e-11 AT4G20820 525 / 0.0 FAD-binding Berberine family protein (.1) Potri.011G163000 [exp] 56 / 9e-11 AT4G20820 532 / 0.0 FAD-binding Berberine family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012641 [exp] 56 / 6e-11 AT5G44440 518 / 2e-180 FAD-binding Berberine family protein (.1) Lus10038439 [exp] 52 / 3e-09 AT1G30700 540 / 0.0 FAD-binding Berberine family protein (.1) Lus10033516 [exp] 49 / 2e-08 AT2G34790 451 / 1e-153 MATERNAL EFFECT EMBRYO ARREST 23, EMBRYO SAC DEVELOPMENT ARREST 28, FAD-binding Berberine family protein (.1) Lus10039682 [exp] 47 / 9e-08 AT5G44440 481 / 9e-166 FAD-binding Berberine family protein (.1) Lus10038446 [exp] 45 / 5e-07 AT4G20860 520 / 0.0 FAD-binding Berberine family protein (.1) Lus10010643 [exp] 45 / 5e-07 AT5G44440 385 / 2e-128 FAD-binding Berberine family protein (.1) Lus10008408 [exp] 45 / 5e-07 AT2G34790 165 / 2e-48 MATERNAL EFFECT EMBRYO ARREST 23, EMBRYO SAC DEVELOPMENT ARREST 28, FAD-binding Berberine family protein (.1) Lus10018119 [exp] 45 / 5e-07 AT2G34790 641 / 0.0 MATERNAL EFFECT EMBRYO ARREST 23, EMBRYO SAC DEVELOPMENT ARREST 28, FAD-binding Berberine family protein (.1) Lus10035466 [exp] 45 / 7e-07 AT1G30700 585 / 0.0 FAD-binding Berberine family protein (.1) Lus10038436 [exp] 45 / 8e-07 AT4G20820 508 / 1e-176 FAD-binding Berberine family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.011G166601.1 pacid=42780485 polypeptide=Potri.011G166601.1.p locus=Potri.011G166601 ID=Potri.011G166601.1.v4.1 annot-version=v4.1 ATGTCAAGGAACCTATTTCTTGAAATTGCATTCAATGAGATACATACAGGAAAGGTTTTCTCTGATGATAACATCGAGGAGCCCACAATGACCTTCATTA ATCCTTATGGAGGAGAAATGAATGAGGTTTCAGAGTCTAGCATTCAATTCCCACATAGAGCTGGTGATCTATACAAGATTATCCATTTGGTGACTGGAGT GAAGAAACCGCGTCGGAAGGACATTTAG
AA sequence Show only first row Show all	>Potri.011G166601.1 pacid=42780485 polypeptide=Potri.011G166601.1.p locus=Potri.011G166601 ID=Potri.011G166601.1.v4.1 annot-version=v4.1 MSRNLFLEIAFNEIHTGKVFSDDNIEEPTMTFINPYGGEMNEVSESSIQFPHRAGDLYKIIHLVTGVKKPRRKDI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34790		MEE23, EDA28	MATERNAL EFFECT EMBRYO ARREST ...		Potri.011G166601 [exp]	0	1
AT5G12260			unknown protein		Potri.012G123450 [exp]	4.58	0.8941
					Potri.002G111832 [exp]	7.07	0.8939
					Potri.001G067200 [exp]	7.74	0.8095
					Potri.003G039626 [exp]	8.48	0.7935
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Potri.008G099201 [exp]	11.22	0.8792
AT5G05070			DHHC-type zinc finger family p...		Potri.006G027500 [exp]	11.61	0.7600
					Potri.003G046750 [exp]	17.29	0.8358
					Potri.012G124633 [exp]	17.54	0.7608
					Potri.012G119350 [exp]	17.86	0.8773
					Potri.008G139250 [exp]	17.94	0.8688

Compare expression of checked genes

Potri.011G166601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.