Potri.011G167101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G20840 82 / 2e-19 FAD-binding Berberine family protein (.1)
AT4G20860 81 / 5e-19 FAD-binding Berberine family protein (.1)
AT1G11770 79 / 4e-18 FAD-binding Berberine family protein (.1)
AT1G30700 78 / 5e-18 FAD-binding Berberine family protein (.1)
AT4G20830 77 / 1e-17 FAD-binding Berberine family protein (.1.2)
AT5G44400 77 / 1e-17 FAD-binding Berberine family protein (.1)
AT1G30710 76 / 3e-17 FAD-binding Berberine family protein (.1)
AT5G44390 74 / 1e-16 FAD-binding Berberine family protein (.1)
AT5G44380 74 / 1e-16 FAD-binding Berberine family protein (.1)
AT1G34575 73 / 3e-16 FAD-binding Berberine family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G470100 101 / 4e-26 AT1G30700 543 / 0.0 FAD-binding Berberine family protein (.1)
Potri.011G158400 91 / 2e-22 AT1G34575 649 / 0.0 FAD-binding Berberine family protein (.1)
Potri.001G462200 89 / 1e-21 AT1G30700 647 / 0.0 FAD-binding Berberine family protein (.1)
Potri.001G459100 86 / 1e-20 AT4G20800 623 / 0.0 FAD-binding Berberine family protein (.1)
Potri.011G155900 85 / 2e-20 AT4G20800 617 / 0.0 FAD-binding Berberine family protein (.1)
Potri.001G459500 83 / 9e-20 AT4G20800 559 / 0.0 FAD-binding Berberine family protein (.1)
Potri.001G462466 79 / 7e-19 AT1G30700 273 / 2e-89 FAD-binding Berberine family protein (.1)
Potri.011G158300 81 / 8e-19 AT1G30700 616 / 0.0 FAD-binding Berberine family protein (.1)
Potri.001G461700 80 / 2e-18 AT4G20820 545 / 0.0 FAD-binding Berberine family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023375 83 / 1e-19 AT1G30700 606 / 0.0 FAD-binding Berberine family protein (.1)
Lus10035466 81 / 6e-19 AT1G30700 585 / 0.0 FAD-binding Berberine family protein (.1)
Lus10023374 81 / 7e-19 AT1G26380 500 / 5e-174 FAD-binding Berberine family protein (.1)
Lus10038437 73 / 4e-16 AT1G26380 484 / 2e-167 FAD-binding Berberine family protein (.1)
Lus10021289 72 / 9e-16 AT1G26380 486 / 4e-168 FAD-binding Berberine family protein (.1)
Lus10009009 71 / 2e-15 AT1G30700 534 / 0.0 FAD-binding Berberine family protein (.1)
Lus10032943 71 / 3e-15 AT4G20820 503 / 2e-174 FAD-binding Berberine family protein (.1)
Lus10038439 71 / 3e-15 AT1G30700 540 / 0.0 FAD-binding Berberine family protein (.1)
Lus10041290 70 / 4e-15 AT2G34790 375 / 8e-126 MATERNAL EFFECT EMBRYO ARREST 23, EMBRYO SAC DEVELOPMENT ARREST 28, FAD-binding Berberine family protein (.1)
Lus10023365 69 / 1e-14 AT1G11770 520 / 0.0 FAD-binding Berberine family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0077 FAD_PCMH PF01565 FAD_binding_4 FAD binding domain
Representative CDS sequence
>Potri.011G167101.1 pacid=42781674 polypeptide=Potri.011G167101.1.p locus=Potri.011G167101 ID=Potri.011G167101.1.v4.1 annot-version=v4.1
ATGGTTGACTTGTTCAATATGAGGTCTATTACTGTTCAATATCATGGTGCTTGGATGATGTCAGGTGCTAAACTAGGGGAAGTTTATTATAGAATTGCTG
AAAAGAGCAAGATTCATAGCTACCCTGCAGGAGTTTGTCCAGCAGTTGGTGTTGGAAGCCATTTAAGTGGAGGTGGATATGGTAACTTAATGAGCAAATA
TGGTTTCTCTGTTGATAATATTGTCGATGCAGTAGTGGTTGATGCTAGTGGTGATGGTTTGGATAGAGAGCGGGAGGGGGGGATCTTTTCTGAGCTATCA
GAGGAGGTGGTGGAGCTAGTTCTGTTTCATGGAAAATTAGACTAG
AA sequence
>Potri.011G167101.1 pacid=42781674 polypeptide=Potri.011G167101.1.p locus=Potri.011G167101 ID=Potri.011G167101.1.v4.1 annot-version=v4.1
MVDLFNMRSITVQYHGAWMMSGAKLGEVYYRIAEKSKIHSYPAGVCPAVGVGSHLSGGGYGNLMSKYGFSVDNIVDAVVVDASGDGLDREREGGIFSELS
EEVVELVLFHGKLD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G20860 FAD-binding Berberine family p... Potri.011G167101 0 1
AT1G13340 Regulator of Vps4 activity in ... Potri.004G100900 2.00 0.8830
AT3G14470 NB-ARC domain-containing disea... Potri.009G056200 3.00 0.8765
AT5G65200 ATPUB38 ARABIDOPSIS THALIANA PLANT U-B... Potri.012G076400 4.47 0.8567
AT3G02430 Protein of unknown function (D... Potri.004G223500 7.74 0.8796
AT1G29280 WRKY ATWRKY65, WRKY6... WRKY DNA-binding protein 65 (.... Potri.004G060900 9.16 0.8683
AT5G36970 NHL25 NDR1/HIN1-like 25 (.1) Potri.012G145500 12.00 0.8565 NHL25.1
AT2G24720 ATGLR2.2 glutamate receptor 2.2 (.1) Potri.018G096300 16.49 0.8440
AT3G14840 Leucine-rich repeat transmembr... Potri.019G009700 19.28 0.8051
AT3G13540 MYB ATMYB5, ATM2 myb domain protein 5 (.1) Potri.013G056400 22.75 0.8502
AT5G53110 RING/U-box superfamily protein... Potri.001G091700 26.00 0.8156

Potri.011G167101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.