Potri.012G002900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46400 47 / 6e-06 Leucine-rich repeat protein kinase family protein (.1)
AT5G38260 43 / 8e-05 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G003301 276 / 2e-94 AT1G66920 70 / 3e-13 Protein kinase superfamily protein (.1.2)
Potri.007G125450 147 / 6e-41 AT5G38260 300 / 2e-92 Protein kinase superfamily protein (.1)
Potri.007G125800 146 / 8e-41 AT5G38260 308 / 1e-95 Protein kinase superfamily protein (.1)
Potri.015G018600 144 / 8e-40 AT1G66920 351 / 9e-113 Protein kinase superfamily protein (.1.2)
Potri.007G125200 139 / 1e-38 AT5G38260 300 / 2e-94 Protein kinase superfamily protein (.1)
Potri.007G125000 137 / 2e-37 AT5G38260 318 / 7e-100 Protein kinase superfamily protein (.1)
Potri.007G126100 132 / 1e-35 AT1G70250 290 / 3e-87 receptor serine/threonine kinase, putative (.1)
Potri.017G007900 121 / 1e-31 AT5G38260 324 / 1e-101 Protein kinase superfamily protein (.1)
Potri.017G009400 106 / 1e-26 AT5G38280 329 / 4e-103 PR5-like receptor kinase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014924 131 / 3e-35 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1)
Lus10025554 117 / 8e-31 AT5G38260 220 / 2e-64 Protein kinase superfamily protein (.1)
Lus10025492 113 / 7e-29 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Lus10008362 108 / 3e-27 AT1G66930 250 / 7e-75 Protein kinase superfamily protein (.1)
Lus10027013 84 / 1e-19 AT5G38280 195 / 3e-58 PR5-like receptor kinase (.1)
Lus10008830 82 / 2e-18 AT4G02750 97 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10025544 76 / 4e-16 AT5G39020 217 / 1e-62 Malectin/receptor-like protein kinase family protein (.1)
Lus10022359 64 / 6e-12 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10007934 58 / 8e-10 AT5G38260 273 / 3e-83 Protein kinase superfamily protein (.1)
Lus10008335 53 / 4e-08 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
PFAM info
Representative CDS sequence
>Potri.012G002900.2 pacid=42782996 polypeptide=Potri.012G002900.2.p locus=Potri.012G002900 ID=Potri.012G002900.2.v4.1 annot-version=v4.1
ATGATTCCATTCATATACGGCACCAGAAAAAACATATTTCTATGTTGCCAGAATCCTATGCAGTCCCCTCTATATATCAGCACTAATTCTTGTATCACTG
GAAAGGATTCTTGCATATCGTCCTTGTCCTCGAAGAAGGCATACCGGTATGTTGTTTCTGGCGATATGAAGGCTTCGGAAGTAGGGGACTCGTGCCATGT
TGATCTAGTGCTTATGGCAACTCCGCCAGATAACAAAAGGAGCCTGTCATACATTGATATCCATAAAATTCTTGTGAATGGTTTGACGCTAGAATGGGAT
ACTATTTACTGTAGAGAATGCAAGGCGCAAGGCTTTTGCTTATTGGATAATACCACTCGTGTCGTCAACTGCTCTAACCCCTGCAACATTTTCCATGGGC
ATCTTTCCAGTGTGCGATTATGTCTTGCGATAAGACTTGTATGTGGGGCTCCATGTGTCTTCATCTTTCTGATCTATAAATGGAGGAGGCATTTACCAAC
GTATGACAACATCGAAGATTTTCTGCAAAGTCACCATAACTTCATGCCCATAAGGTACTCATACTCGGAAATTAAAAAGATGACCAACTATTTCAAGGAA
AAATTGGGTGAGGGTGGCTAG
AA sequence
>Potri.012G002900.2 pacid=42782996 polypeptide=Potri.012G002900.2.p locus=Potri.012G002900 ID=Potri.012G002900.2.v4.1 annot-version=v4.1
MIPFIYGTRKNIFLCCQNPMQSPLYISTNSCITGKDSCISSLSSKKAYRYVVSGDMKASEVGDSCHVDLVLMATPPDNKRSLSYIDIHKILVNGLTLEWD
TIYCRECKAQGFCLLDNTTRVVNCSNPCNIFHGHLSSVRLCLAIRLVCGAPCVFIFLIYKWRRHLPTYDNIEDFLQSHHNFMPIRYSYSEIKKMTNYFKE
KLGEGG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G46400 Leucine-rich repeat protein ki... Potri.012G002900 0 1
AT2G17040 NAC ANAC036 NAC domain containing protein ... Potri.005G103200 1.00 0.9828
AT2G25410 RING/U-box superfamily protein... Potri.001G154500 2.44 0.9026
Potri.019G110602 3.00 0.9078
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Potri.009G083300 3.87 0.8850
AT5G64810 WRKY ATWRKY51, WRKY5... ARABIDOPSIS THALIANA WRKY DNA-... Potri.005G085200 4.00 0.8821 WRKY51.1
AT1G45616 AtRLP6 receptor like protein 6 (.1) Potri.012G005600 4.47 0.8940
AT1G12740 CYP87A2 "cytochrome P450, family 87, s... Potri.001G270700 6.32 0.8986
AT3G48090 ATEDS1, EDS1 enhanced disease susceptibilit... Potri.015G069600 9.48 0.9046 EDS1.2
AT4G35840 RING/U-box superfamily protein... Potri.005G244800 9.79 0.8899
AT5G40010 ASD, AATP1 ATPase-in-Seed-Development, AA... Potri.004G012700 15.87 0.8987

Potri.012G002900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.