Potri.012G003200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G66920 281 / 4e-91 Protein kinase superfamily protein (.1.2)
AT1G66910 276 / 8e-89 Protein kinase superfamily protein (.1)
AT5G38280 268 / 1e-85 PR5K PR5-like receptor kinase (.1)
AT5G38260 264 / 3e-84 Protein kinase superfamily protein (.1)
AT1G70250 267 / 5e-84 receptor serine/threonine kinase, putative (.1)
AT4G18250 266 / 2e-83 receptor serine/threonine kinase, putative (.1)
AT1G66930 260 / 2e-82 Protein kinase superfamily protein (.1)
AT5G39030 262 / 3e-82 Protein kinase superfamily protein (.1)
AT1G66980 265 / 2e-81 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
AT1G67000 262 / 2e-81 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G003000 560 / 0 AT1G66920 356 / 5e-115 Protein kinase superfamily protein (.1.2)
Potri.012G003500 558 / 0 AT1G66920 358 / 4e-116 Protein kinase superfamily protein (.1.2)
Potri.012G002800 553 / 0 AT1G66920 346 / 2e-111 Protein kinase superfamily protein (.1.2)
Potri.015G018200 518 / 0 AT1G66920 368 / 1e-119 Protein kinase superfamily protein (.1.2)
Potri.015G018000 503 / 6e-178 AT1G66920 355 / 2e-114 Protein kinase superfamily protein (.1.2)
Potri.007G126200 422 / 4e-147 AT1G66920 333 / 3e-107 Protein kinase superfamily protein (.1.2)
Potri.007G125600 422 / 2e-146 AT5G38260 357 / 3e-115 Protein kinase superfamily protein (.1)
Potri.017G035500 417 / 2e-144 AT1G66920 336 / 2e-107 Protein kinase superfamily protein (.1.2)
Potri.007G125100 404 / 6e-141 AT1G66920 347 / 2e-113 Protein kinase superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026761 359 / 2e-122 AT1G67000 334 / 4e-107 Protein kinase superfamily protein (.1)
Lus10025547 359 / 1e-121 AT1G66920 345 / 2e-111 Protein kinase superfamily protein (.1.2)
Lus10025553 360 / 3e-121 AT1G70250 341 / 4e-108 receptor serine/threonine kinase, putative (.1)
Lus10014923 348 / 2e-117 AT1G67000 335 / 2e-107 Protein kinase superfamily protein (.1)
Lus10014924 280 / 3e-90 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1)
Lus10022359 267 / 7e-86 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10027085 257 / 1e-85 AT1G66980 275 / 1e-84 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10025545 257 / 6e-85 AT5G39020 316 / 1e-101 Malectin/receptor-like protein kinase family protein (.1)
Lus10008335 267 / 2e-84 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
Lus10025492 265 / 2e-84 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Potri.012G003200.1 pacid=42783485 polypeptide=Potri.012G003200.1.p locus=Potri.012G003200 ID=Potri.012G003200.1.v4.1 annot-version=v4.1
ATGGGAAAGATCCATCACGTCAACGTTATACGCTTAGTTGGTTACTGTGCTGATGGATTTCGAAGAGCTCTAGTCTATGATTACCTGCCAAATGAATCAC
TAGAGAAATTTGTATCTTCAGAACATGGCGAAACCTCCAGTCTTAGCTGGGAGAAGCTTCAGGATATTGCTCTTGGCATGGCTAAAGGCATCGAATATCT
TCACCAAGGCTGTGATCAGCGAATCCTCCATTTCGACATCAAACCTCATAACATCTTGTTAGATGACCATTTCAATCCAAAGATTTCTGATTTCGGTCTG
GCAAAGCTGTGCTCCAAGGATCAGAGTGCCGTGTCCATGACTACAGCTCGAGGAACCATGGGGTATATTGCACCTGAAGTTTTCTCTAGGAACTTTGGGC
ATGTTTCCTATAAGTCTGATGTTTATAGTTTTGGAATGGTGTTGCTCGAAATGGTCGGAGGGAGGAAGACTATCGATGATAAGGTAGAGAACAGCAACCA
AATCTACTTCCCAGAATGGGTCTACAACAGCCTGGATAAAGGAGAAGAGCTGAGAATCAGAATTGAAAAGGAGGGGGACGCGCAAATCGCAAAGAAGCTG
ACTCTTGTAGGACTATGGTGCATTCAGTGGCACCCCGTGGATTGTCCGTCCATGAATACTGTCGTGCAAATGTTGGAAGGAGAAGGAGACAAGTTAACAA
TGCCTCCTAGCCCTTTTGCTTCTGCAGGTCCTGGAAGAATGCATGCAAATATGCCAGGGAGACCTCATTATCAAGCGTTGGAGGTGATCTCTGAAACAGA
GTAA
AA sequence
>Potri.012G003200.1 pacid=42783485 polypeptide=Potri.012G003200.1.p locus=Potri.012G003200 ID=Potri.012G003200.1.v4.1 annot-version=v4.1
MGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSLSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGL
AKLCSKDQSAVSMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVLLEMVGGRKTIDDKVENSNQIYFPEWVYNSLDKGEELRIRIEKEGDAQIAKKL
TLVGLWCIQWHPVDCPSMNTVVQMLEGEGDKLTMPPSPFASAGPGRMHANMPGRPHYQALEVISETE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G66920 Protein kinase superfamily pro... Potri.012G003200 0 1
AT1G66920 Protein kinase superfamily pro... Potri.012G003000 1.00 0.9989
AT1G66920 Protein kinase superfamily pro... Potri.012G003500 1.73 0.9939
AT1G70250 receptor serine/threonine kina... Potri.012G003450 2.82 0.9910
AT2G42350 RING/U-box superfamily protein... Potri.011G063100 3.16 0.9905
AT2G16050 Cysteine/Histidine-rich C1 dom... Potri.010G205200 3.46 0.9738
AT1G66920 Protein kinase superfamily pro... Potri.012G002800 6.48 0.9855
AT1G66920 Protein kinase superfamily pro... Potri.012G003400 7.41 0.9752
AT5G08350 GRAM domain-containing protein... Potri.004G068000 11.66 0.9814
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Potri.003G011132 12.36 0.9719
AT2G40740 WRKY ATWRKY55, WRKY5... WRKY DNA-binding protein 55 (.... Potri.013G090400 16.12 0.9736

Potri.012G003200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.