Potri.012G003301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G66920 69 / 4e-13 Protein kinase superfamily protein (.1.2)
AT1G18390 62 / 1e-10 Protein kinase superfamily protein (.1.2)
AT1G67000 55 / 4e-08 Protein kinase superfamily protein (.1)
AT1G66880 52 / 3e-07 Protein kinase superfamily protein (.1)
AT5G38210 51 / 4e-07 Protein kinase family protein (.1)
AT1G66930 50 / 1e-06 Protein kinase superfamily protein (.1)
AT1G67025 47 / 4e-06 unknown protein
AT1G66910 44 / 0.0001 Protein kinase superfamily protein (.1)
AT5G38260 44 / 0.0001 Protein kinase superfamily protein (.1)
AT5G50290 42 / 0.0003 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G002900 276 / 5e-94 AT3G46400 47 / 6e-06 Leucine-rich repeat protein kinase family protein (.1)
Potri.015G018600 225 / 4e-69 AT1G66920 351 / 9e-113 Protein kinase superfamily protein (.1.2)
Potri.007G125800 179 / 1e-51 AT5G38260 308 / 1e-95 Protein kinase superfamily protein (.1)
Potri.007G125450 179 / 2e-51 AT5G38260 300 / 2e-92 Protein kinase superfamily protein (.1)
Potri.007G125000 170 / 2e-48 AT5G38260 318 / 7e-100 Protein kinase superfamily protein (.1)
Potri.017G007900 167 / 4e-47 AT5G38260 324 / 1e-101 Protein kinase superfamily protein (.1)
Potri.007G126100 166 / 6e-47 AT1G70250 290 / 3e-87 receptor serine/threonine kinase, putative (.1)
Potri.008G125500 129 / 2e-33 AT1G67000 309 / 3e-94 Protein kinase superfamily protein (.1)
Potri.017G009500 126 / 2e-32 AT5G38280 327 / 3e-102 PR5-like receptor kinase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014924 210 / 4e-63 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1)
Lus10008362 179 / 2e-52 AT1G66930 250 / 7e-75 Protein kinase superfamily protein (.1)
Lus10025554 178 / 2e-52 AT5G38260 220 / 2e-64 Protein kinase superfamily protein (.1)
Lus10025492 165 / 2e-46 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1)
Lus10022359 113 / 4e-28 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1)
Lus10027117 108 / 6e-28 AT1G18390 47 / 8e-06 Protein kinase superfamily protein (.1.2)
Lus10027119 108 / 2e-26 AT5G38260 210 / 3e-60 Protein kinase superfamily protein (.1)
Lus10008830 102 / 8e-25 AT4G02750 97 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10007934 101 / 8e-24 AT5G38260 273 / 3e-83 Protein kinase superfamily protein (.1)
Lus10027013 91 / 2e-21 AT5G38280 195 / 3e-58 PR5-like receptor kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF13947 GUB_WAK_bind Wall-associated receptor kinase galacturonan-binding
Representative CDS sequence
>Potri.012G003301.1 pacid=42782555 polypeptide=Potri.012G003301.1.p locus=Potri.012G003301 ID=Potri.012G003301.1.v4.1 annot-version=v4.1
ATGTTTAGTAGAGTTCTTCTATGTGCTGTCTTTTTTGTGGTCCTCCTCATAAACCATGAGCCCTGTGCTGCTAAAACAAATCATCTTTGTGAACATCCTT
CTTCGTGTGGCCACCTTACTAACATTAGCTACCCTTTTCGACTACAAGGCGACCCGGAAAACTGCGGTGATCCAAGCTATCAGTTGACTTGCGAGAACAA
TCGTGCAATTCTAAGCCTGTATTCAGGAAAGTACTATGTGAAGGAGATCAATTACAAATATTCAACGATTCGGATAGCTGATGTTGGTTTACAAGAAGAT
AATTGCTCTACGCTTCCTCTGTATCATTTGTCAGAGAACAACTTCACAAAAACATATTTCTATGTTGCCAGAATCCTATGCAGTCCCCTCTATATATCAG
CACTAATTCTTTCCTCGAAGAAGGCATACCGGTATGTTGTTTCTGGCGATATGAAGGCTTCGGAAGTAGGGGACTCGTGCCCCGTTGATCTAGTGGTTAT
GGCAACTCCGCTAGATAACAAAAGGAGCCTGTCATACATTGATATCCATAAAATTCTTGTGAATGGTTTGACGCTAGAATGGGATACTATATACTGTAGA
GAATGCAAGGCGCAAGGCTTTTGCTTATTGGATAATACCACTCGATTATGTCTTGCGATAAGACTTGTATGCGGGGCTCCATGTGTCTTCATCTTTCTGA
TCTATAAATGGAGGAGGAGGCATTTATCAACGTATGACAATATCGAAGATTTTCTGCAAAGTCACCATAACTTCATGCCCATAAGGTACTCATACCCGGA
AATTAAAAAGATGACAAGCTATTTCAAGGAAAAATTGGGTGAGGGTGGCTATTGTTGA
AA sequence
>Potri.012G003301.1 pacid=42782555 polypeptide=Potri.012G003301.1.p locus=Potri.012G003301 ID=Potri.012G003301.1.v4.1 annot-version=v4.1
MFSRVLLCAVFFVVLLINHEPCAAKTNHLCEHPSSCGHLTNISYPFRLQGDPENCGDPSYQLTCENNRAILSLYSGKYYVKEINYKYSTIRIADVGLQED
NCSTLPLYHLSENNFTKTYFYVARILCSPLYISALILSSKKAYRYVVSGDMKASEVGDSCPVDLVVMATPLDNKRSLSYIDIHKILVNGLTLEWDTIYCR
ECKAQGFCLLDNTTRLCLAIRLVCGAPCVFIFLIYKWRRRHLSTYDNIEDFLQSHHNFMPIRYSYPEIKKMTSYFKEKLGEGGYC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G66920 Protein kinase superfamily pro... Potri.012G003301 0 1
AT5G49630 AAP6 amino acid permease 6 (.1) Potri.006G236100 7.74 0.9042
AT3G19920 unknown protein Potri.007G073600 8.66 0.9042
Potri.019G016104 11.48 0.7916
Potri.008G053150 11.61 0.9042
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Potri.016G122500 16.12 0.8505 GRAS66
AT3G51020 unknown protein Potri.002G011500 17.00 0.8087
AT2G14760 bHLH bHLH084 basic helix-loop-helix (bHLH) ... Potri.014G017100 18.70 0.7812
Potri.006G017750 22.44 0.8618
Potri.003G109601 31.98 0.7602
AT5G44265 Bifunctional inhibitor/lipid-t... Potri.017G013200 37.22 0.6697

Potri.012G003301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.