Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70250 93 / 4e-23 receptor serine/threonine kinase, putative (.1) AT1G66920 93 / 4e-23 Protein kinase superfamily protein (.1.2) AT5G38280 91 / 2e-22 PR5K PR5-like receptor kinase (.1) AT5G38260 91 / 2e-22 Protein kinase superfamily protein (.1) AT1G66980 90 / 5e-22 GDPDL2, SNC4 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) AT5G39030 89 / 1e-21 Protein kinase superfamily protein (.1) AT5G38240 89 / 2e-21 Protein kinase family protein (.1) AT5G39020 88 / 2e-21 Malectin/receptor-like protein kinase family protein (.1) AT1G67000 88 / 2e-21 Protein kinase superfamily protein (.1) AT1G66910 87 / 6e-21 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G003200 [exp] 254 / 2e-87 AT1G66920 280 / 2e-90 Protein kinase superfamily protein (.1.2) Potri.012G003000 [exp] 259 / 3e-85 AT1G66920 356 / 5e-115 Protein kinase superfamily protein (.1.2) Potri.012G003500 [exp] 259 / 3e-85 AT1G66920 358 / 4e-116 Protein kinase superfamily protein (.1.2) Potri.012G002800 [exp] 253 / 9e-83 AT1G66920 346 / 2e-111 Protein kinase superfamily protein (.1.2) Potri.015G018050 [exp] 234 / 6e-81 AT5G38240 147 / 3e-42 Protein kinase family protein (.1) Potri.015G018200 [exp] 228 / 4e-73 AT1G66920 368 / 1e-119 Protein kinase superfamily protein (.1.2) Potri.015G018000 [exp] 223 / 3e-71 AT1G66920 355 / 2e-114 Protein kinase superfamily protein (.1.2) Potri.007G126200 [exp] 178 / 2e-54 AT1G66920 333 / 3e-107 Protein kinase superfamily protein (.1.2) Potri.007G125600 [exp] 174 / 1e-52 AT5G38260 357 / 3e-115 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025553 [exp] 120 / 1e-32 AT1G70250 341 / 4e-108 receptor serine/threonine kinase, putative (.1) Lus10026761 [exp] 119 / 1e-32 AT1G67000 334 / 4e-107 Protein kinase superfamily protein (.1) Lus10014923 [exp] 119 / 2e-32 AT1G67000 335 / 2e-107 Protein kinase superfamily protein (.1) Lus10025547 [exp] 116 / 2e-31 AT1G66920 345 / 2e-111 Protein kinase superfamily protein (.1.2) Lus10038814 [exp] 87 / 8e-22 AT5G38250 165 / 2e-46 Protein kinase family protein (.1) Lus10014924 [exp] 86 / 1e-20 AT1G67000 349 / 5e-112 Protein kinase superfamily protein (.1) Lus10025492 [exp] 86 / 1e-20 AT5G38260 326 / 1e-102 Protein kinase superfamily protein (.1) Lus10022359 [exp] 83 / 2e-19 AT1G66980 322 / 3e-101 Glycerophosphodiester phosphodiesterase \(GDPD\) like 2, suppressor of npr1-1 constitutive 4 (.1) Lus10025491 [exp] 81 / 7e-19 AT5G53110 80 / 2e-16 RING/U-box superfamily protein (.1) Lus10008335 [exp] 79 / 4e-18 AT1G70250 316 / 8e-98 receptor serine/threonine kinase, putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G003450.1 pacid=42783414 polypeptide=Potri.012G003450.1.p locus=Potri.012G003450 ID=Potri.012G003450.1.v4.1 annot-version=v4.1 ATGGTGTTGCTTGAAATGGTCGGAGGGAGGAAGACTATCGATGATAAGGTAGAGAACAGCAACCAAATCTACTTCCCAGAATGGGTCTACAACAGCCTGG ATAAAGGAGAAGAGCTGAGAATCAGAATTGAAAAGGAGGGGGACGCGCAAATCGCAAAGAAGCTGACTCTCGTAGGACTATGGTGCATTCAGTGGCACCC CGTGGATCGTCCGTCAATGAATACTGTCGTGCAAATGTTGGAAGGAGAAGGAGACAAGTTAACAATGCCTCCTAGCCCTTTCGCTTCTGCAGGTCCTGGA AGAATGCATGCAAATATGCCAGGGAGACCTCATTATCAAGCGTTGGAAGTGATCTCTGAAACAGAGTAA
AA sequence Show only first row Show all	>Potri.012G003450.1 pacid=42783414 polypeptide=Potri.012G003450.1.p locus=Potri.012G003450 ID=Potri.012G003450.1.v4.1 annot-version=v4.1 MVLLEMVGGRKTIDDKVENSNQIYFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGEGDKLTMPPSPFASAGPG RMHANMPGRPHYQALEVISETE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70250			receptor serine/threonine kina...		Potri.012G003450 [exp]	0	1
AT1G66920			Protein kinase superfamily pro...		Potri.012G003500 [exp]	1.73	0.9932
AT1G66920			Protein kinase superfamily pro...		Potri.012G003200 [exp]	2.82	0.9910
AT1G66920			Protein kinase superfamily pro...		Potri.012G003400 [exp]	3.16	0.9809
AT1G66920			Protein kinase superfamily pro...		Potri.012G003000 [exp]	4.58	0.9893
AT2G42350			RING/U-box superfamily protein...		Potri.011G063100 [exp]	9.53	0.9793
AT1G66910			Protein kinase superfamily pro...		Potri.015G018101 [exp]	11.22	0.9710
AT1G07390		AtRLP1	receptor like protein 1 (.1.2....		Potri.018G124400 [exp]	11.40	0.9771
AT1G61560		ATMLO6, MLO6	MILDEW RESISTANCE LOCUS O 6, S...		Potri.008G041400 [exp]	15.71	0.9689	Pt-MLO12.2
AT5G11210		ATGLR2.5	ARABIDOPSIS THALIANA GLU, glut...		Potri.011G062900 [exp]	17.29	0.9680
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003800 [exp]	18.11	0.9788

Compare expression of checked genes

Potri.012G003450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.