Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27940 82 / 6e-20 ABCB13, PGP13 ATP-binding cassette B13, P-glycoprotein 13 (.1) AT3G28345 82 / 8e-20 MDR13, ABCB15 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1) AT1G28010 81 / 2e-19 MDR12, ATABCB14, ABCB14, PGP14 multi-drug resistance 12, Arabidopsis thaliana ATP-binding cassette B14, ATP-binding cassette B14, P-glycoprotein 14 (.1) AT3G28860 80 / 4e-19 ABCB19, ATMDR11, ATMDR1, PGP19, MDR11, MDR1, ATPGP19, ATABCB19 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1) AT3G28390 80 / 5e-19 ABCB18, PGP18 ATP-binding cassette B18, P-glycoprotein 18 (.1) AT3G28380 79 / 6e-19 ABCB17, PGP17 ATP-binding cassette B17, P-glycoprotein 17 (.1) AT2G36910 79 / 1e-18 ATMDR1, ATPGP1, PGP1, ABCB1 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) AT3G28360 78 / 2e-18 ABCB16, PGP16 ATP-binding cassette B16, P-glycoprotein 16 (.1) AT4G25960 78 / 2e-18 ABCB2, PGP2 ATP-binding cassette B2, P-glycoprotein 2 (.1) AT3G28415 77 / 6e-18 ABCB22 ATP-binding cassette B22, ABC transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G093600 [exp] 79 / 1e-18 AT2G36910 2120 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) Potri.017G085000 [exp] 78 / 2e-18 AT3G28345 1774 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1) Potri.006G123900 [exp] 76 / 7e-18 AT2G36910 2138 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) Potri.018G087100 [exp] 76 / 1e-17 AT3G28345 1259 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1) Potri.017G074000 [exp] 75 / 2e-17 AT3G28345 1831 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1) Potri.011G133800 [exp] 74 / 3e-17 AT3G28345 1268 / 0.0 multi-drug resistance 13, ATP-binding cassette B15, ABC transporter family protein (.1) Potri.003G094400 [exp] 74 / 4e-17 AT4G25960 2000 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1) Potri.010G210100 [exp] 73 / 8e-17 AT3G55320 2237 / 0.0 ATP-binding cassette B20, P-glycoprotein 20 (.1) Potri.001G139600 [exp] 73 / 1e-16 AT4G25960 1962 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015595 [exp] 109 / 2e-29 AT3G28860 971 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1) Lus10032911 [exp] 107 / 1e-28 AT3G28860 960 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1) Lus10000910 [exp] 89 / 4e-22 AT4G25960 808 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1) Lus10004571 [exp] 87 / 1e-21 AT4G25960 1732 / 0.0 ATP-binding cassette B2, P-glycoprotein 2 (.1) Lus10023929 [exp] 80 / 4e-19 AT2G36910 2300 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) Lus10014427 [exp] 79 / 7e-19 AT2G36910 1913 / 0.0 P-GLYCOPROTEIN 1, ARABIDOPSIS THALIANA P GLYCOPROTEIN1, ATP-binding cassette B1, ATP binding cassette subfamily B1 (.1) Lus10011976 [exp] 77 / 1e-18 AT1G02520 355 / 9e-114 multi-drug resistance 8, ATP-binding cassette B11, P-glycoprotein 11 (.1) Lus10004583 [exp] 78 / 2e-18 AT4G18050 1660 / 0.0 ATP-binding cassette B9, P-glycoprotein 9 (.1) Lus10009988 [exp] 77 / 7e-18 AT3G62150 1896 / 0.0 ATP-binding cassette B21, P-glycoprotein 21 (.1) Lus10030674 [exp] 77 / 8e-18 AT3G28860 2271 / 0.0 P-GLYCOPROTEIN 19, MULTIDRUG RESISTANCE PROTEIN 11, Arabidopsis thaliana ATP-binding cassette B19, ATP-binding cassette B19, ATP binding cassette subfamily B19 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00005 [poplar] [flax] ABC_tran ABC transporter
Representative CDS sequence Show only first row Show all	>Potri.012G004150.1 pacid=42784009 polypeptide=Potri.012G004150.1.p locus=Potri.012G004150 ID=Potri.012G004150.1.v4.1 annot-version=v4.1 ATGTTCCCTAAGAGCCCAGATCTTGAAAAGATCATGGGGAGAACTGAATTTCAGAACATCCAATTCTACTACCCACTACGACCAGAAGTGAAAGTTCTCC GCAACTTCAGCTTACAAATTGAAGCTGGATTAAAGGTGGCACTTGCAGGGCCAAGTGGATCAGGAAAGTTCTCAGTTTTGGCCCTTTTGTTAAGATTCGA TGACCCTAGGGAAGGAAAGCTTATAATTGTAAAGAAGGATATGAGAGAATAA
AA sequence Show only first row Show all	>Potri.012G004150.1 pacid=42784009 polypeptide=Potri.012G004150.1.p locus=Potri.012G004150 ID=Potri.012G004150.1.v4.1 annot-version=v4.1 MFPKSPDLEKIMGRTEFQNIQFYYPLRPEVKVLRNFSLQIEAGLKVALAGPSGSGKFSVLALLLRFDDPREGKLIIVKKDMRE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G27940		ABCB13, PGP13	ATP-binding cassette B13, P-gl...		Potri.012G004150 [exp]	0	1
AT3G57880			Calcium-dependent lipid-bindin...		Potri.004G043000 [exp]	14.49	0.7488
AT4G21510			F-box family protein (.1)		Potri.011G042800 [exp]	19.97	0.7162
AT2G19330		PIRL6	plant intracellular ras group-...		Potri.006G072700 [exp]	23.10	0.6903
AT1G76310		CYCB2;4	CYCLIN B2;4 (.1)		Potri.005G251400 [exp]	29.69	0.7425	Pt-CYCB2.2
AT4G26270		PFK3	phosphofructokinase 3 (.1)		Potri.006G152600 [exp]	45.16	0.7187
AT1G16900			Alg9-like mannosyltransferase ...		Potri.011G110800 [exp]	75.06	0.6696
AT3G59940			Galactose oxidase/kelch repeat...		Potri.017G000700 [exp]	79.09	0.7152
AT3G28610			P-loop containing nucleoside t...		Potri.012G072300 [exp]	100.32	0.6980
AT4G38870			F-box and associated interacti...		Potri.008G144000 [exp]	154.11	0.6594
AT3G02970		EXL6	EXORDIUM like 6 (.1)		Potri.013G080100 [exp]	207.73	0.6634

Compare expression of checked genes

Potri.012G004150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.