Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53730 226 / 3e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G44220 146 / 5e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G52470 129 / 1e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 129 / 2e-37 NHL1 NDR1/HIN1-like 1 (.1) AT2G35960 129 / 3e-37 NHL12 NDR1/HIN1-like 12 (.1) AT5G06330 128 / 4e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22200 126 / 4e-36 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35970 120 / 6e-34 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G09590 116 / 3e-32 NHL22 NDR1/HIN1-like 22 (.1) AT4G01410 87 / 5e-21 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G002400 [exp] 311 / 5e-109 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G019600 [exp] 140 / 6e-42 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071500 [exp] 134 / 4e-39 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.006G204200 [exp] 127 / 2e-36 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.005G088000 [exp] 100 / 2e-26 AT3G44220 194 / 5e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 94 / 1e-23 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 94 / 1e-23 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 73 / 1e-15 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G003800 [exp] 67 / 8e-14 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032932 [exp] 207 / 2e-67 AT5G53730 211 / 4e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021286 [exp] 133 / 5e-39 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 132 / 1e-38 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10004202 [exp] 127 / 1e-36 AT3G11660 257 / 8e-88 NDR1/HIN1-like 1 (.1) Lus10043410 [exp] 123 / 1e-34 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10029406 [exp] 122 / 1e-34 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1) Lus10034175 [exp] 119 / 3e-33 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10013327 [exp] 94 / 2e-23 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1) Lus10000157 [exp] 93 / 3e-23 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10030193 [exp] 86 / 6e-20 AT4G01410 185 / 3e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.012G006000.1 pacid=42783187 polypeptide=Potri.012G006000.1.p locus=Potri.012G006000 ID=Potri.012G006000.1.v4.1 annot-version=v4.1 ATGTCTCTAGTCTCCATAGAATCTCCAAAACACTGTGCCAAGCAAGGACTAAACGTCAACAAGCTATCCAAGAAGCTTTTCTTTGCCTCTTCGGCATTCT TCACCACACTTCTCTCACTAATATTGATCATCTGGCTTATCCTGCGCCCTGCCAAACCTGAGTTCTCTCTCAAAGAGGCTGATATCTACCAACTCAGCCT CTCAGCTCCTAACCTTCTTAACTCCTCTATCCAACTTACCCTACTTTCCAAGAACCCGAATCAAAAAGTCGGCGTTTACTACGACGAATTACAAGTTTAT GCTGCCTACAGGGGTCAGCAGATAACTGTTGACTCCCCCCTTCCTCCATTCTACCAAGGACATCAGGATAGCAATCTATTAACAGCATCTTTAGTTGGAA CTGGATTGCCTGTGGCTCCATCCTTCAATTACGAAGTGGGGCGTGATCAGACTGCTGGAAAACTAGTTCTAAATCTAAGGGTTAATGGAAGGATCAGGTG GAAGGTAGGGACTTGGGTTTCAGGCAGATACCGAATCAATGTTAATTGCCTTGCAGTTATGGCTCTTGGACCTACTCTTCCAACAGGACCTTTGAGTTCA AAGCAAGGGACTGCATGCTCCACCACTGTCTGA
AA sequence Show only first row Show all	>Potri.012G006000.1 pacid=42783187 polypeptide=Potri.012G006000.1.p locus=Potri.012G006000 ID=Potri.012G006000.1.v4.1 annot-version=v4.1 MSLVSIESPKHCAKQGLNVNKLSKKLFFASSAFFTTLLSLILIIWLILRPAKPEFSLKEADIYQLSLSAPNLLNSSIQLTLLSKNPNQKVGVYYDELQVY AAYRGQQITVDSPLPPFYQGHQDSNLLTASLVGTGLPVAPSFNYEVGRDQTAGKLVLNLRVNGRIRWKVGTWVSGRYRINVNCLAVMALGPTLPTGPLSS KQGTACSTTV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53730			Late embryogenesis abundant (L...		Potri.012G006000 [exp]	0	1
AT3G21150	CO	EIP6, BBX32	EMF1-Interacting Protein 1, B-...		Potri.008G007000 [exp]	1.41	0.9578
AT3G44880		PAO, LLS1, ACD1	LETHAL LEAF-SPOT 1 HOMOLOG, AC...		Potri.004G217200 [exp]	2.44	0.9485
AT2G15680		AtCML30	calmodulin-like 30, Calcium-bi...		Potri.009G102500 [exp]	4.47	0.9585
AT1G76520			Auxin efflux carrier family pr...		Potri.001G456400 [exp]	4.89	0.9438
AT4G22920		ATNYE1, SGR1, S...	non-yellowing 1 (.1)		Potri.003G119600 [exp]	8.48	0.9387
AT5G65110		ATACX2, ACX2	acyl-CoA oxidase 2 (.1.2)		Potri.007G090400 [exp]	9.94	0.9240
AT1G56010	NAC	NAC1, ANAC021, ...	Arabidopsis NAC domain contain...		Potri.005G098200 [exp]	12.16	0.9471
					Potri.008G181801 [exp]	13.22	0.9236
AT5G23810		AAP7	amino acid permease 7 (.1.2)		Potri.001G470000 [exp]	13.49	0.9319
AT4G32250			Protein kinase superfamily pro...		Potri.006G255700 [exp]	14.38	0.9377

Compare expression of checked genes

Potri.012G006000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.