Potri.012G006700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49470 171 / 1e-53 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT4G10480 168 / 3e-52 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT1G33040 159 / 8e-49 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
AT3G12390 150 / 3e-45 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 146 / 6e-44 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G003300 196 / 3e-63 AT3G49470 172 / 4e-54 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.001G034400 152 / 4e-46 AT3G12390 204 / 5e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.003G190800 150 / 2e-45 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.006G032000 145 / 2e-43 AT3G12390 215 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015579 188 / 6e-60 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10032927 184 / 2e-58 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10026133 154 / 1e-47 AT3G12390 204 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10041610 154 / 3e-47 AT3G12390 229 / 7e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10024109 150 / 3e-46 AT3G12390 198 / 1e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10008687 135 / 1e-37 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Potri.012G006700.3 pacid=42783788 polypeptide=Potri.012G006700.3.p locus=Potri.012G006700 ID=Potri.012G006700.3.v4.1 annot-version=v4.1
ATGTCACCCGGTCCCGTCGTTGAGGCTGAACCCGCCGCCGCCGCCGCCACTGCTGAGGAGGTCACCTCCACTGTGGAAGATACACAGCAGAAGAAGCCTC
CTCAGCAGGACGTGGATGAACCTGTGGTGGAGGACGTGAAAGAAGATGAGAAGGAAGAGGACGATGATGATGATGATGAGGACGATGATGATGAAGATGA
TGACAAGGATGATGATACCCCAGGTGCTAATGGGAGTTCCAAGCAGAGCAGAAGTGAAAAGAAGAGTCGCAAGGCAATGTTGAAGCTTGGCATGAAACCT
GTTACTGGTGTTAGCAGGGTCACCATCAAGAGAACCAAAAATATACTGTTTTTTATCTCAAAGCCTGATGTCTTCAAGAGCCCAAATTCTGAGACCTATA
TCATATTTGGAGAGGCAAAGATAGAGGATTTGAGCTCTCAGCTGCAGACACAGGCTGCTCAGCAGTTTAGGGTGCCAGACATGTCATCTATGTTACCAAA
ACCAGATGCTTCTACTGCAGCTGCTGCTGCACCAGCAGATGAAGAAGAGGAAGAAGTCGATGAGACAGGGGTTGAGCCTAGGGACATTGATCTTGTTATG
ACACAGGCTGGAGTTTCTAGGAGCAAGGCTGTCAAGGCTCTCCAGACGAATAATGGGGACATTGTCAGTGCTATCATGGAGCTTACTACTTAG
AA sequence
>Potri.012G006700.3 pacid=42783788 polypeptide=Potri.012G006700.3.p locus=Potri.012G006700 ID=Potri.012G006700.3.v4.1 annot-version=v4.1
MSPGPVVEAEPAAAAATAEEVTSTVEDTQQKKPPQQDVDEPVVEDVKEDEKEEDDDDDDEDDDDEDDDKDDDTPGANGSSKQSRSEKKSRKAMLKLGMKP
VTGVSRVTIKRTKNILFFISKPDVFKSPNSETYIIFGEAKIEDLSSQLQTQAAQQFRVPDMSSMLPKPDASTAAAAAPADEEEEEVDETGVEPRDIDLVM
TQAGVSRSKAVKALQTNNGDIVSAIMELTT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G49470 NACA2 nascent polypeptide-associated... Potri.012G006700 0 1
AT5G11880 Pyridoxal-dependent decarboxyl... Potri.009G119300 1.73 0.8544
AT4G35850 Pentatricopeptide repeat (PPR)... Potri.001G341400 4.24 0.8289
AT3G01280 VDAC1, ATVDAC1 ARABIDOPSIS THALIANA VOLTAGE D... Potri.017G078200 4.89 0.8207
AT4G20440 SMB small nuclear ribonucleoprotei... Potri.011G155700 7.34 0.8209
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Potri.003G181200 7.74 0.7841
AT5G66860 Ribosomal protein L25/Gln-tRNA... Potri.007G039700 9.16 0.8044
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Potri.006G190900 12.48 0.7242
AT3G17465 RPL3P ribosomal protein L3 plastid (... Potri.010G002300 12.96 0.7788 Pt-RPL3.3
AT5G60390 GTP binding Elongation factor ... Potri.010G218600 13.00 0.7807
AT5G64670 Ribosomal protein L18e/L15 sup... Potri.016G002400 14.14 0.7951

Potri.012G006700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.