Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05260 63 / 3e-13 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) AT5G15180 63 / 4e-13 Peroxidase superfamily protein (.1) AT5G17820 62 / 9e-13 Peroxidase superfamily protein (.1) AT4G26010 61 / 2e-12 Peroxidase superfamily protein (.1) AT1G77100 60 / 3e-12 Peroxidase superfamily protein (.1) AT4G11290 58 / 1e-11 Peroxidase superfamily protein (.1) AT2G18980 58 / 2e-11 Peroxidase superfamily protein (.1) AT2G18150 57 / 3e-11 Peroxidase superfamily protein (.1) AT1G14550 57 / 3e-11 Peroxidase superfamily protein (.1) AT3G21770 57 / 4e-11 Peroxidase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G006800 [exp] 128 / 1e-37 AT1G05260 291 / 2e-97 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.015G003500 [exp] 120 / 7e-35 AT1G05260 291 / 1e-97 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.015G003600 [exp] 105 / 7e-29 AT1G05260 285 / 6e-95 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.006G069600 [exp] 68 / 5e-15 AT2G41480 498 / 6e-179 Peroxidase superfamily protein (.1) Potri.018G131600 [exp] 67 / 7e-15 AT2G41480 478 / 4e-171 Peroxidase superfamily protein (.1) Potri.013G066800 [exp] 62 / 5e-13 AT4G26010 360 / 1e-124 Peroxidase superfamily protein (.1) Potri.017G037900 [exp] 62 / 6e-13 AT1G05260 481 / 2e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Potri.010G236870 [exp] 59 / 7e-12 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1) Potri.010G236900 [exp] 59 / 7e-12 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032926 [exp] 72 / 2e-16 AT1G05260 292 / 5e-98 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10005679 [exp] 67 / 2e-14 AT4G26010 353 / 3e-122 Peroxidase superfamily protein (.1) Lus10020312 [exp] 64 / 1e-13 AT1G04170 845 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1) Lus10015555 [exp] 64 / 2e-13 AT2G41480 432 / 9e-153 Peroxidase superfamily protein (.1) Lus10018375 [exp] 62 / 1e-12 AT5G17820 293 / 1e-98 Peroxidase superfamily protein (.1) Lus10005614 [exp] 61 / 2e-12 AT5G42180 461 / 6e-165 peroxidase 64, Peroxidase superfamily protein (.1) Lus10009902 [exp] 61 / 2e-12 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1) Lus10024206 [exp] 58 / 2e-12 AT1G14550 118 / 1e-33 Peroxidase superfamily protein (.1) Lus10039680 [exp] 61 / 3e-12 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1) Lus10027164 [exp] 60 / 4e-12 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.012G006900.1 pacid=42783802 polypeptide=Potri.012G006900.1.p locus=Potri.012G006900 ID=Potri.012G006900.1.v4.1 annot-version=v4.1 ATGATGAGTTCCAGGAAGCTAGCTCAACTATGTATAACTTTTTGGGTGGCAGTCCTGTTTTGTCCAAGTGTCCATTCTCAGCTTCAAGTAGGATTTTATA GAAATTCATGCAGGAGGGCTGAGTCAACTGTGAGAGATGATGTTAGAGATGCTCTCAGACAGGATAGAGGGGTGGCTGCTGGTCTCGTGAGACTGCACTT TCATGATTGTTTTGTCAGGATGCAGCAACAGAAAATCAAGTGA
AA sequence Show only first row Show all	>Potri.012G006900.1 pacid=42783802 polypeptide=Potri.012G006900.1.p locus=Potri.012G006900 ID=Potri.012G006900.1.v4.1 annot-version=v4.1 MMSSRKLAQLCITFWVAVLFCPSVHSQLQVGFYRNSCRRAESTVRDDVRDALRQDRGVAAGLVRLHFHDCFVRMQQQKIK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G15180			Peroxidase superfamily protein...		Potri.012G006900 [exp]	0	1
					Potri.008G070501 [exp]	1.41	1.0000
AT3G44350	NAC	ANAC061	NAC domain containing protein ...		Potri.006G179800 [exp]	3.46	1.0000	NAC140
					Potri.003G157850 [exp]	6.92	0.9996
					Potri.008G073450 [exp]	9.00	1.0000
					Potri.003G096450 [exp]	9.16	1.0000
					Potri.002G022400 [exp]	9.79	0.9922
					Potri.005G122150 [exp]	9.89	1.0000
					Potri.008G131750 [exp]	10.95	1.0000
AT5G22860			Serine carboxypeptidase S28 fa...		Potri.009G002300 [exp]	12.48	0.9952
					Potri.015G034150 [exp]	13.41	1.0000

Compare expression of checked genes

Potri.012G006900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.