Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27590 137 / 3e-42 Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 62 / 5e-12 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT5G02600 57 / 2e-10 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT3G53530 57 / 3e-10 NAKR3 SODIUM POTASSIUM ROOT DEFECTIVE 3, Chloroplast-targeted copper chaperone protein (.1.2) AT3G56891 55 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 52 / 4e-09 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 51 / 1e-08 Heavy metal transport/detoxification superfamily protein (.1) AT1G66240 47 / 2e-07 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT5G27690 47 / 8e-07 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 44 / 3e-06 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G003800 [exp] 219 / 1e-74 AT4G27590 141 / 7e-44 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.016G080400 [exp] 58 / 1e-10 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.006G213900 [exp] 56 / 8e-10 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.002G092200 [exp] 54 / 8e-10 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 53 / 2e-09 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 53 / 2e-09 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 52 / 4e-09 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 51 / 1e-08 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 50 / 3e-08 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032924 [exp] 129 / 5e-38 AT4G27590 122 / 4e-35 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016436 [exp] 55 / 6e-10 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 55 / 6e-10 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10025294 [exp] 56 / 8e-10 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10024435 [exp] 56 / 1e-09 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10005875 [exp] 55 / 2e-09 AT2G28660 109 / 4e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10022508 [exp] 53 / 3e-09 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 53 / 3e-09 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10040870 [exp] 52 / 2e-08 AT2G28660 110 / 2e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10016708 [exp] 50 / 2e-08 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.012G007200.1 pacid=42783184 polypeptide=Potri.012G007200.1.p locus=Potri.012G007200 ID=Potri.012G007200.1.v4.1 annot-version=v4.1 ATGGCAATTAACATGCAGATTGTTCTGGCTTCCAATTGCGAGAATGTTGAGGCACAGTACGTGGAGATGATCGTCCCTCTTTATTCCCATGGATGTGAGA AGAAAGTGAAGAAGACCTTATCTCATCTCAAAGGAATTTACTCTGTAAATGTAGATTATTATCAACAAAAGGTGACAGTGTGGGGGATATGCAACAAATA CGATGTCTTAGCTACCGTAAAGAGCAAAAGAAAGGAAGCTCGCTTTTGGAATCCCCAAGACAACGTTCAAATGGAAGAAGATGAAGAATCACAACCACCA TCATCACCACCACCACCAAAAGACTCCAAAACTATTCCTTCTTTGACCCTAATGAAGGCTCGTTCTCTAACTCGCTCCTTGAGTTGGAAAGTATGGAAAA AGGTTTTCACGAGGACGTTCTCCTTCTAA
AA sequence Show only first row Show all	>Potri.012G007200.1 pacid=42783184 polypeptide=Potri.012G007200.1.p locus=Potri.012G007200 ID=Potri.012G007200.1.v4.1 annot-version=v4.1 MAINMQIVLASNCENVEAQYVEMIVPLYSHGCEKKVKKTLSHLKGIYSVNVDYYQQKVTVWGICNKYDVLATVKSKRKEARFWNPQDNVQMEEDEESQPP SSPPPPKDSKTIPSLTLMKARSLTRSLSWKVWKKVFTRTFSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27590			Heavy metal transport/detoxifi...		Potri.012G007200 [exp]	0	1
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Potri.016G049600 [exp]	5.38	0.8656	PGIP.2
AT4G37180	GARP		Homeodomain-like superfamily p...		Potri.005G134600 [exp]	5.74	0.8367
AT2G39370		MAKR4	MEMBRANE-ASSOCIATED KINASE REG...		Potri.006G214700 [exp]	6.70	0.8549
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Potri.011G114500 [exp]	8.36	0.8590
					Potri.018G060100 [exp]	11.83	0.8448
AT3G12500		PR-3, PR3, CHI-...	PATHOGENESIS-RELATED 3, basic ...		Potri.009G141700 [exp]	12.64	0.8235	Pt-CHIA5.2
AT1G32700			PLATZ transcription factor fam...		Potri.005G130300 [exp]	12.96	0.8448
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Potri.001G395100 [exp]	16.00	0.7999
AT1G60010			unknown protein		Potri.010G095400 [exp]	18.33	0.8280
AT5G67060	bHLH	HEC1, bHLH088	HECATE 1, basic helix-loop-hel...		Potri.007G044600 [exp]	20.34	0.8412

Compare expression of checked genes

Potri.012G007200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.