Potri.012G007866 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G259224 67 / 2e-17 ND /
Potri.012G008845 67 / 2e-17 ND /
Potri.016G020750 64 / 1e-16 ND /
Potri.004G077201 47 / 7e-10 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G007866.1 pacid=42782802 polypeptide=Potri.012G007866.1.p locus=Potri.012G007866 ID=Potri.012G007866.1.v4.1 annot-version=v4.1
ATGTTATTTGAATTTTATGTAATCGTTTTTCTTCTTCAGGATTTGCAGCAGGAACTTTCTGCTAAGTTTGTTATTTCAATTCCAATAATCTCTCAAGTTT
GTTGA
AA sequence
>Potri.012G007866.1 pacid=42782802 polypeptide=Potri.012G007866.1.p locus=Potri.012G007866 ID=Potri.012G007866.1.v4.1 annot-version=v4.1
MLFEFYVIVFLLQDLQQELSAKFVISIPIISQVC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G007866 0 1
Potri.012G008845 1.00 0.9994
Potri.001G259224 1.41 0.9924
Potri.016G020750 4.89 0.9740
AT3G55870 ADC synthase superfamily prote... Potri.008G066600 4.89 0.9824 Pt-ASA1.1,ASA%2C,pseudogene
AT1G52540 Protein kinase superfamily pro... Potri.006G173800 7.93 0.9726
AT1G65420 NPQ7 NONPHOTOCHEMICAL QUENCHING 7, ... Potri.008G076900 9.38 0.9427
AT3G59780 Rhodanese/Cell cycle control p... Potri.019G098950 10.86 0.9338
Potri.014G065700 11.22 0.9659
AT1G79810 PEX2, TED3, ATP... ARABIDOPSIS PEROXIN 2, Pex2/Pe... Potri.001G186000 12.00 0.9246 Pt-TED3.2
Potri.012G007445 15.87 0.9754

Potri.012G007866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.